<?xml version="1.0" encoding="UTF-8"?>
<urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9" xmlns:image="http://www.google.com/schemas/sitemap-image/1.1">
  <url>
    <loc>https://www.bookshop.lt/products/egocentricity-and-mysticism-columbia-university-press-9780231169127-an-anthropological-study-ernst-tugendhat</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780231169127.jpg?v=1767770664</image:loc>
      <image:title>Egocentricity and Mysticism</image:title>
      <image:caption>Book cover of: Egocentricity and Mysticism. By: Ernst Tugendhat</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-cases-in-primary-care-taylor-francis-ltd-9781846199851-paediatrics-samar-razaq</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781846199851.jpg?v=1767770664</image:loc>
      <image:title>Difficult Cases in Primary Care</image:title>
      <image:caption>Book cover of: Difficult Cases in Primary Care. By: Samar Razaq</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/ego-psychology-and-communication-taylor-francis-inc-9780202363318-theory-for-the-interview-norman-a-polansky</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780202363318.jpg?v=1767770666</image:loc>
      <image:title>Ego Psychology and Communication</image:title>
      <image:caption>Book cover of: Ego Psychology and Communication. By: Norman A. Polansky</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/ego-mechanisms-of-defense-american-psychiatric-association-publishing-9780880484046-a-guide-for-clinicians-and-researchers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780880484046.jpg?v=1767770666</image:loc>
      <image:title>Ego Mechanisms of Defense</image:title>
      <image:caption>Book cover of: Ego Mechanisms of Defense</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-consultations-with-adolescents-taylor-francis-ltd-9781857758825-chris-donovan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781857758825.jpg?v=1767770666</image:loc>
      <image:title>Difficult Consultations with Adolescents</image:title>
      <image:caption>Book cover of: Difficult Consultations with Adolescents. By: Chris Donovan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-decisions-in-vascular-surgery-springer-international-publishing-ag-9783319814780-an-evidence-based-approach-christopher-l-skelly</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783319814780.jpg?v=1767770665</image:loc>
      <image:title>Difficult Decisions in Vascular Surgery</image:title>
      <image:caption>Book cover of: Difficult Decisions in Vascular Surgery. By: Christopher L. Skelly</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-conditions-in-laparoscopic-urologic-surgery-springer-international-publishing-ag-9783319849409-ahmed-al-kandari</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783319849409.jpg?v=1767770666</image:loc>
      <image:title>Difficult Conditions in Laparoscopic Urologic Surgery</image:title>
      <image:caption>Book cover of: Difficult Conditions in Laparoscopic Urologic Surgery. By: Ahmed Al-Kandari</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-cases-in-primary-care-taylor-francis-ltd-9781846195112-women-s-health</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781846195112.jpg?v=1767770665</image:loc>
      <image:title>Difficult Cases in Primary Care</image:title>
      <image:caption>Book cover of: Difficult Cases in Primary Care</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2012-volume-2-taylor-francis-ltd-9780415642637-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415642637.jpg?v=1767770663</image:loc>
      <image:title>EGLR 2012 Volume 2</image:title>
      <image:caption>Book cover of: EGLR 2012 Volume 2. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/ego-and-the-dynamic-ground-state-university-of-new-york-press-9780791422564</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780791422564.jpg?v=1767770663</image:loc>
      <image:title>Ego and the Dynamic Ground</image:title>
      <image:caption>Book cover of: Ego and the Dynamic Ground</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/ego-and-analysis-of-defense-jason-aronson-publishers-9780765703361-paul-gray</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780765703361.jpg?v=1767770666</image:loc>
      <image:title>Ego and Analysis of Defense</image:title>
      <image:caption>Book cover of: Ego and Analysis of Defense. By: Paul Gray</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/ego-damage-and-repair-taylor-francis-ltd-9780367102982-toward-a-psychodynamic-neurology</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367102982.jpg?v=1767770666</image:loc>
      <image:title>Ego Damage and Repair</image:title>
      <image:caption>Book cover of: Ego Damage and Repair</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-behavior-in-early-childhood-sage-publications-inc-9781412937146-positive-discipline-for-prek-3-classrooms-and-beyond-ronald-mah</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412937146.jpg?v=1767770667</image:loc>
      <image:title>Difficult Behavior in Early Childhood</image:title>
      <image:caption>Book cover of: Difficult Behavior in Early Childhood. By: Ronald Mah</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/ego-and-the-mechanisms-of-defence-taylor-francis-ltd-9780367327774</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367327774.jpg?v=1767770664</image:loc>
      <image:title>Ego and the Mechanisms of Defence</image:title>
      <image:caption>Book cover of: Ego and the Mechanisms of Defence</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-conversations-bloomsbury-publishing-plc-9781475845846-a-toolkit-for-educators-in-handling-real-life-situations-anni-k-reinking</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781475845846.jpg?v=1767770667</image:loc>
      <image:title>Difficult Conversations</image:title>
      <image:caption>Book cover of: Difficult Conversations. By: Anni K. Reinking</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2013-v2-taylor-francis-ltd-9780415703987-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415703987.jpg?v=1767770665</image:loc>
      <image:title>EGLR 2013 V2</image:title>
      <image:caption>Book cover of: EGLR 2013 V2. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2012-v3-taylor-francis-ltd-9780415642668-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415642668.jpg?v=1767770668</image:loc>
      <image:title>EGLR 2012 V3</image:title>
      <image:caption>Book cover of: EGLR 2012 V3. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-cases-in-endourology-springer-london-ltd-9781447168829-ahmed-al-kandari</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781447168829.jpg?v=1767770666</image:loc>
      <image:title>Difficult Cases in Endourology</image:title>
      <image:caption>Book cover of: Difficult Cases in Endourology. By: Ahmed Al-Kandari</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2014-v1-taylor-francis-ltd-9781138781009-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138781009.jpg?v=1767770665</image:loc>
      <image:title>EGLR 2014 V1</image:title>
      <image:caption>Book cover of: EGLR 2014 V1. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egoist-penguin-books-ltd-9780140430349-george-meredith</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780140430349.jpg?v=1767770667</image:loc>
      <image:title>Egoist</image:title>
      <image:caption>Book cover of: Egoist. By: George Meredith</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-child-and-the-problem-of-discipline-taylor-francis-ltd-9781138899384-c-w-valentine</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138899384.jpg?v=1767770666</image:loc>
      <image:title>Difficult Child and the Problem of Discipline</image:title>
      <image:caption>Book cover of: Difficult Child and the Problem of Discipline. By: C. W. Valentine</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-decisions-in-head-and-neck-oncologic-surgery-springer-nature-switzerland-ag-9783030151225-zhen-gooi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783030151225.jpg?v=1767770664</image:loc>
      <image:title>Difficult Decisions in Head and Neck Oncologic Surgery</image:title>
      <image:caption>Book cover of: Difficult Decisions in Head and Neck Oncologic Surgery. By: Zhen Gooi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2011-volume-2-taylor-francis-ltd-9780415506663-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415506663.jpg?v=1767770666</image:loc>
      <image:title>EGLR 2011 Volume 2</image:title>
      <image:caption>Book cover of: EGLR 2011 Volume 2. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-bloomsbury-publishing-plc-9781538138885-mothering-challenging-adult-children-through-conflict-and-change-judith-r-smith</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781538138885.jpg?v=1767770669</image:loc>
      <image:title>Difficult</image:title>
      <image:caption>Book cover of: Difficult. By: Judith R. Smith</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2014-v3-taylor-francis-ltd-9781138781078-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138781078.jpg?v=1767770666</image:loc>
      <image:title>EGLR 2014 V3</image:title>
      <image:caption>Book cover of: EGLR 2014 V3. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2013-v3-taylor-francis-ltd-9780415703994-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415703994.jpg?v=1767770667</image:loc>
      <image:title>EGLR 2013 V3</image:title>
      <image:caption>Book cover of: EGLR 2013 V3. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-and-complicated-cases-in-refractive-surgery-springer-verlag-berlin-and-heidelberg-gmbh-co-kg-9783662521304-jorge-l-ali</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783662521304.jpg?v=1767770665</image:loc>
      <image:title>Difficult and Complicated Cases in Refractive Surgery</image:title>
      <image:caption>Book cover of: Difficult and Complicated Cases in Refractive Surgery. By: Jorge L. Alió</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2013-v1-taylor-francis-ltd-9780415870474-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415870474.jpg?v=1767770665</image:loc>
      <image:title>EGLR 2013 V1</image:title>
      <image:caption>Book cover of: EGLR 2013 V1. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differenzierung-und-integration-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820483482-grundlagen-der-organisationsforschung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820483482.jpg?v=1767770666</image:loc>
      <image:title>Differenzierung und Integration</image:title>
      <image:caption>Book cover of: Differenzierung und Integration</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2011-volume-3-and-cumulative-index-taylor-francis-ltd-9780415536394-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415536394.jpg?v=1767770666</image:loc>
      <image:title>EGLR 2011 Volume 3 and Cumulative Index</image:title>
      <image:caption>Book cover of: EGLR 2011 Volume 3 and Cumulative Index. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/ego-psychology-ii-columbia-university-press-9780231044707-psychoanalytic-developmental-psychology</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780231044707.jpg?v=1767770666</image:loc>
      <image:title>Ego Psychology II</image:title>
      <image:caption>Book cover of: Ego Psychology II</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2014-v2-taylor-francis-ltd-9781138781023-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138781023.jpg?v=1767770666</image:loc>
      <image:title>EGLR 2014 V2</image:title>
      <image:caption>Book cover of: EGLR 2014 V2. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2011-volume-1-taylor-francis-ltd-9780415507332-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415507332.jpg?v=1767770667</image:loc>
      <image:title>EGLR 2011 Volume 1</image:title>
      <image:caption>Book cover of: EGLR 2011 Volume 1. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2010-set-taylor-francis-ltd-9780080969343-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780080969343.jpg?v=1767770668</image:loc>
      <image:title>EGLR 2010 SET</image:title>
      <image:caption>Book cover of: EGLR 2010 SET. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differenzierung-oder-integration-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820481471-ein-beitrag-zur-adaequaten-beschulung-lernbehinderter-aus-schulpaedagogischer-sicht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820481471.jpg?v=1767770669</image:loc>
      <image:title>Differenzierung oder Integration</image:title>
      <image:caption>Book cover of: Differenzierung oder Integration</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2010-volume-3-taylor-francis-ltd-9780080969398-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780080969398.jpg?v=1767770667</image:loc>
      <image:title>EGLR 2010 Volume 3</image:title>
      <image:caption>Book cover of: EGLR 2010 Volume 3. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difficult-behavior-in-early-childhood-sage-publications-inc-9781412937153-positive-discipline-for-prek-3-classrooms-and-beyond-ronald-mah</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412937153.jpg?v=1767770668</image:loc>
      <image:title>Difficult Behavior in Early Childhood</image:title>
      <image:caption>Book cover of: Difficult Behavior in Early Childhood. By: Ronald Mah</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2005-taylor-francis-ltd-9780728204669-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728204669.jpg?v=1767770667</image:loc>
      <image:title>EGLR 2005</image:title>
      <image:caption>Book cover of: EGLR 2005. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentielle-bedingungsanalyse-verbaler-gedaechtnisleistungen-bei-schulkindern-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820493726</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820493726.jpg?v=1767770666</image:loc>
      <image:title>Differentielle Bedingungsanalyse verbaler Gedaechtnisleistungen bei Schulkindern</image:title>
      <image:caption>Book cover of: Differentielle Bedingungsanalyse verbaler Gedaechtnisleistungen bei Schulkindern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2011-set-taylor-francis-ltd-9780415631150-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415631150.jpg?v=1767770669</image:loc>
      <image:title>EGLR 2011 Set</image:title>
      <image:caption>Book cover of: EGLR 2011 Set. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2005-taylor-francis-ltd-9780728204676-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728204676.jpg?v=1767770672</image:loc>
      <image:title>EGLR 2005</image:title>
      <image:caption>Book cover of: EGLR 2005. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2005-taylor-francis-ltd-9780728204652-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728204652.jpg?v=1767770668</image:loc>
      <image:title>EGLR 2005</image:title>
      <image:caption>Book cover of: EGLR 2005. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2010-volume-2-taylor-francis-ltd-9780728205819-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728205819.jpg?v=1767770668</image:loc>
      <image:title>EGLR 2010 Volume 2</image:title>
      <image:caption>Book cover of: EGLR 2010 Volume 2. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differenzen-und-interferenzen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876904245</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876904245.jpg?v=1767770668</image:loc>
      <image:title>Differenzen und Interferenzen</image:title>
      <image:caption>Book cover of: Differenzen und Interferenzen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2008-volume-3-taylor-francis-ltd-9780728205444-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728205444.jpg?v=1767770670</image:loc>
      <image:title>EGLR 2008 Volume 3</image:title>
      <image:caption>Book cover of: EGLR 2008 Volume 3. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2004-taylor-francis-ltd-9780728204348-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728204348.jpg?v=1767770672</image:loc>
      <image:title>EGLR 2004</image:title>
      <image:caption>Book cover of: EGLR 2004. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differently-wired-workman-publishing-9781523506316-a-parent-s-guide-to-raising-an-atypical-child-with-confidence-and-hope-deborah-reber</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781523506316.jpg?v=1767770670</image:loc>
      <image:title>Differently Wired</image:title>
      <image:caption>Book cover of: Differently Wired. By: Deborah Reber</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiation-through-personality-types-sage-publications-inc-9781412917704-a-framework-for-instruction-assessment-and-classroom-management-jane-a-g-kise</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412917704.jpg?v=1767770669</image:loc>
      <image:title>Differentiation Through Personality Types</image:title>
      <image:caption>Book cover of: Differentiation Through Personality Types. By: Jane A. G. Kise</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiation-is-an-expectation-taylor-francis-ltd-9781596671645-a-school-leader-s-guide-to-building-a-culture-of-differentiation-kimberly-kappler-hewitt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781596671645.jpg?v=1767770669</image:loc>
      <image:title>Differentiation Is an Expectation</image:title>
      <image:caption>Book cover of: Differentiation Is an Expectation. By: Kimberly Kappler Hewitt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiation-through-learning-styles-and-memory-sage-publications-inc-9781412955447-marilee-sprenger</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412955447.jpg?v=1767770668</image:loc>
      <image:title>Differentiation Through Learning Styles and Memory</image:title>
      <image:caption>Book cover of: Differentiation Through Learning Styles and Memory. By: Marilee Sprenger</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2003-taylor-francis-ltd-9780728204027-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728204027.jpg?v=1767770668</image:loc>
      <image:title>EGLR 2003</image:title>
      <image:caption>Book cover of: EGLR 2003. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2010-volume-1-taylor-francis-ltd-9780728205802-hazel-marshall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728205802.jpg?v=1767770668</image:loc>
      <image:title>EGLR 2010 Volume 1</image:title>
      <image:caption>Book cover of: EGLR 2010 Volume 1. By: Hazel Marshall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differenzialgleichungen-fur-dummies-wiley-vch-verlag-gmbh-9783527715589-steven-holzner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783527715589.jpg?v=1767770669</image:loc>
      <image:title>Differenzialgleichungen fur Dummies</image:title>
      <image:caption>Book cover of: Differenzialgleichungen fur Dummies. By: Steven Holzner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2002-taylor-francis-ltd-9780728203839-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203839.jpg?v=1767770667</image:loc>
      <image:title>EGLR 2002</image:title>
      <image:caption>Book cover of: EGLR 2002. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiation-through-personality-types-sage-publications-inc-9781412917711-a-framework-for-instruction-assessment-and-classroom-management-jane-a-g-kise</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412917711.jpg?v=1767770671</image:loc>
      <image:title>Differentiation Through Personality Types</image:title>
      <image:caption>Book cover of: Differentiation Through Personality Types. By: Jane A. G. Kise</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2004-taylor-francis-ltd-9780728204355-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728204355.jpg?v=1767770670</image:loc>
      <image:title>EGLR 2004</image:title>
      <image:caption>Book cover of: EGLR 2004. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiation-is-an-expectation-taylor-francis-ltd-9781138470675-a-school-leader-s-guide-to-building-a-culture-of-differentiation-kimberly-kappler-hewitt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138470675.jpg?v=1767770669</image:loc>
      <image:title>Differentiation Is an Expectation</image:title>
      <image:caption>Book cover of: Differentiation Is an Expectation. By: Kimberly Kappler Hewitt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentielle-psychophysiologie-valenzkontraerer-aktivierungsdimensionen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820493504</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820493504.jpg?v=1767770670</image:loc>
      <image:title>Differentielle Psychophysiologie valenzkontraerer Aktivierungsdimensionen</image:title>
      <image:caption>Book cover of: Differentielle Psychophysiologie valenzkontraerer Aktivierungsdimensionen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiation-through-learning-styles-and-memory-sage-publications-inc-9781412955454-marilee-sprenger</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412955454.jpg?v=1767770671</image:loc>
      <image:title>Differentiation Through Learning Styles and Memory</image:title>
      <image:caption>Book cover of: Differentiation Through Learning Styles and Memory. By: Marilee Sprenger</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2002-taylor-francis-ltd-9780728203822-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203822.jpg?v=1767770668</image:loc>
      <image:title>EGLR 2002</image:title>
      <image:caption>Book cover of: EGLR 2002. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2004-cumulative-index-taylor-francis-ltd-9780728204379-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728204379.jpg?v=1767770670</image:loc>
      <image:title>EGLR 2004 Cumulative Index</image:title>
      <image:caption>Book cover of: EGLR 2004 Cumulative Index. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2001-taylor-francis-ltd-9780728203624-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203624.jpg?v=1767770670</image:loc>
      <image:title>EGLR 2001</image:title>
      <image:caption>Book cover of: EGLR 2001. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiation-taylor-francis-inc-9781571107084-from-planning-to-practice-grades-6-12-rick-wormeli</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781571107084.jpg?v=1767770670</image:loc>
      <image:title>Differentiation</image:title>
      <image:caption>Book cover of: Differentiation. By: Rick Wormeli</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2000-taylor-francis-ltd-9780728203372-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203372.jpg?v=1767770669</image:loc>
      <image:title>EGLR 2000</image:title>
      <image:caption>Book cover of: EGLR 2000. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-with-graphic-organizers-sage-publications-inc-9781412959766-tools-to-foster-critical-and-creative-thinking-patti-drapeau</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412959766.jpg?v=1767770668</image:loc>
      <image:title>Differentiating With Graphic Organizers</image:title>
      <image:caption>Book cover of: Differentiating With Graphic Organizers. By: Patti Drapeau</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiation-at-work-k-5-sage-publications-inc-9781412971317-principles-lessons-and-strategies-lane-narvaez</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412971317.jpg?v=1767770673</image:loc>
      <image:title>Differentiation at Work, K-5</image:title>
      <image:caption>Book cover of: Differentiation at Work, K-5. By: Lane Narvaez</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2003-taylor-francis-ltd-9780728204041-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728204041.jpg?v=1767770670</image:loc>
      <image:title>EGLR 2003</image:title>
      <image:caption>Book cover of: EGLR 2003. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2003-taylor-francis-ltd-9780728204034-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728204034.jpg?v=1767770668</image:loc>
      <image:title>EGLR 2003</image:title>
      <image:caption>Book cover of: EGLR 2003. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiation-for-the-adolescent-learner-sage-publications-inc-9781412940542-accommodating-brain-development-language-literacy-and-special-needs-glenda-beamon-crawford</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412940542.jpg?v=1767770670</image:loc>
      <image:title>Differentiation for the Adolescent Learner</image:title>
      <image:caption>Book cover of: Differentiation for the Adolescent Learner. By: Glenda Beamon Crawford</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-the-high-school-classroom-sage-publications-inc-9781412917155-solution-strategies-for-18-common-obstacles-kathie-f-nunley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412917155.jpg?v=1767770672</image:loc>
      <image:title>Differentiating the High School Classroom</image:title>
      <image:caption>Book cover of: Differentiating the High School Classroom. By: Kathie F. Nunley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2000-taylor-francis-ltd-9780728203389-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203389.jpg?v=1767770671</image:loc>
      <image:title>EGLR 2000</image:title>
      <image:caption>Book cover of: EGLR 2000. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2000-taylor-francis-ltd-9780728203365-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203365.jpg?v=1767770672</image:loc>
      <image:title>EGLR 2000</image:title>
      <image:caption>Book cover of: EGLR 2000. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2001-taylor-francis-ltd-9780728203631-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203631.jpg?v=1767770670</image:loc>
      <image:title>EGLR 2001</image:title>
      <image:caption>Book cover of: EGLR 2001. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-with-graphic-organizers-sage-publications-inc-9781412959759-tools-to-foster-critical-and-creative-thinking-patti-drapeau</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412959759.jpg?v=1767770671</image:loc>
      <image:title>Differentiating With Graphic Organizers</image:title>
      <image:caption>Book cover of: Differentiating With Graphic Organizers. By: Patti Drapeau</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2002-taylor-francis-ltd-9780728203815-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203815.jpg?v=1767770669</image:loc>
      <image:title>EGLR 2002</image:title>
      <image:caption>Book cover of: EGLR 2002. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-the-high-school-classroom-sage-publications-inc-9781412917162-solution-strategies-for-18-common-obstacles-kathie-f-nunley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412917162.jpg?v=1767770670</image:loc>
      <image:title>Differentiating the High School Classroom</image:title>
      <image:caption>Book cover of: Differentiating the High School Classroom. By: Kathie F. Nunley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1999-taylor-francis-ltd-9780728203280-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203280.jpg?v=1767770671</image:loc>
      <image:title>EGLR 1999</image:title>
      <image:caption>Book cover of: EGLR 1999. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiation-for-real-classrooms-sage-publications-inc-9781412972475-making-it-simple-making-it-work-kathleen-kryza</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412972475.jpg?v=1767770672</image:loc>
      <image:title>Differentiation for Real Classrooms</image:title>
      <image:caption>Book cover of: Differentiation for Real Classrooms. By: Kathleen Kryza</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-instruction-bloomsbury-publishing-plc-9781610484602-matching-strategies-with-objectives-marie-menna-pagliaro</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781610484602.jpg?v=1767770673</image:loc>
      <image:title>Differentiating Instruction</image:title>
      <image:caption>Book cover of: Differentiating Instruction. By: Marie Menna Pagliaro</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2001-taylor-francis-ltd-9780728203617-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203617.jpg?v=1767770669</image:loc>
      <image:title>EGLR 2001</image:title>
      <image:caption>Book cover of: EGLR 2001. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-2002-taylor-francis-ltd-9780728203808-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiation-for-gifted-and-talented-students-sage-publications-inc-9781412904308</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412904308.jpg?v=1767770673</image:loc>
      <image:title>Differentiation for Gifted and Talented Students</image:title>
      <image:caption>Book cover of: Differentiation for Gifted and Talented Students</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1998-taylor-francis-ltd-9780728203099-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203099.jpg?v=1767770670</image:loc>
      <image:title>EGLR 1998</image:title>
      <image:caption>Book cover of: EGLR 1998. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-instruction-for-students-with-learning-disabilities-sage-publications-inc-9781412998598-new-best-practices-for-general-and-special-educators-william-n-bender</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412998598.jpg?v=1767770672</image:loc>
      <image:title>Differentiating Instruction for Students With Learning Disabilities</image:title>
      <image:caption>Book cover of: Differentiating Instruction for Students With Learning Disabilities. By: William N. Bender</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-by-readiness-taylor-francis-ltd-9781596671379-strategies-and-lesson-plans-for-tiered-instruction-grades-k-8-joni-turville</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781596671379.jpg?v=1767770669</image:loc>
      <image:title>Differentiating By Readiness</image:title>
      <image:caption>Book cover of: Differentiating By Readiness. By: Joni Turville</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-math-instruction-k-8-sage-publications-inc-9781452255453-common-core-mathematics-in-the-21st-century-classroom</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781452255453.jpg?v=1767770673</image:loc>
      <image:title>Differentiating Math Instruction, K-8</image:title>
      <image:caption>Book cover of: Differentiating Math Instruction, K-8</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-by-student-interest-taylor-francis-ltd-9781596670471-practical-lessons-and-strategies-joni-turville</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781596670471.jpg?v=1767770671</image:loc>
      <image:title>Differentiating by Student Interest</image:title>
      <image:caption>Book cover of: Differentiating by Student Interest. By: Joni Turville</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-instruction-bloomsbury-publishing-plc-9781610484596-matching-strategies-with-objectives-marie-menna-pagliaro</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781610484596.jpg?v=1767770672</image:loc>
      <image:title>Differentiating Instruction</image:title>
      <image:caption>Book cover of: Differentiating Instruction. By: Marie Menna Pagliaro</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-for-the-young-child-sage-publications-inc-9781412975551-teaching-strategies-across-the-content-areas-prek-3-joan-f-smutny</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412975551.jpg?v=1767770673</image:loc>
      <image:title>Differentiating for the Young Child</image:title>
      <image:caption>Book cover of: Differentiating for the Young Child. By: Joan F. Smutny</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-instruction-for-at-risk-students-bloomsbury-publishing-plc-9781578869831-what-to-do-and-how-to-do-it-rita-stafford-dunn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781578869831.jpg?v=1767770670</image:loc>
      <image:title>Differentiating Instruction for At-Risk Students</image:title>
      <image:caption>Book cover of: Differentiating Instruction for At-Risk Students. By: Rita Stafford Dunn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-by-student-interest-taylor-francis-ltd-9781138435636-practical-lessons-and-strategies-joni-turville</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138435636.jpg?v=1767770671</image:loc>
      <image:title>Differentiating by Student Interest</image:title>
      <image:caption>Book cover of: Differentiating by Student Interest. By: Joni Turville</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-assessment-in-middle-and-high-school-mathematics-and-science-taylor-francis-ltd-9781596671072-sheryn-spencer-waterman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781596671072.jpg?v=1767770671</image:loc>
      <image:title>Differentiating Assessment in Middle and High School Mathematics and Science</image:title>
      <image:caption>Book cover of: Differentiating Assessment in Middle and High School Mathematics and Science. By: Sheryn Spencer Waterman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1996-taylor-francis-ltd-9780728202689-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202689.jpg?v=1767770671</image:loc>
      <image:title>EGLR 1996</image:title>
      <image:caption>Book cover of: EGLR 1996. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1998-taylor-francis-ltd-9780728203082-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203082.jpg?v=1767770672</image:loc>
      <image:title>EGLR 1998</image:title>
      <image:caption>Book cover of: EGLR 1998. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-literacy-strategies-for-english-language-learners-grades-k-6-sage-publications-inc-9781412996488-gayle-gregory</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412996488.jpg?v=1767770675</image:loc>
      <image:title>Differentiated Literacy Strategies for English Language Learners, Grades K–6</image:title>
      <image:caption>Book cover of: Differentiated Literacy Strategies for English Language Learners, Grades K–6. By: Gayle Gregory</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1999-taylor-francis-ltd-9780728203266-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203266.jpg?v=1767770671</image:loc>
      <image:title>EGLR 1999</image:title>
      <image:caption>Book cover of: EGLR 1999. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1995-taylor-francis-ltd-9780728202573-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202573.jpg?v=1767770670</image:loc>
      <image:title>EGLR 1995</image:title>
      <image:caption>Book cover of: EGLR 1995. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-science-instruction-and-assessment-for-learners-with-special-needs-k-8-sage-publications-inc-9781412993999-kevin-d-finson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412993999.jpg?v=1767770673</image:loc>
      <image:title>Differentiating Science Instruction and Assessment for Learners With Special Needs, K–8</image:title>
      <image:caption>Book cover of: Differentiating Science Instruction and Assessment for Learners With Special Needs, K–8. By: Kevin D. Finson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-school-leadership-sage-publications-inc-9781412917728-effective-collaboration-communication-and-change-through-personality-type-jane-a-g-kise-jane-a-g-kise</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412917728.jpg?v=1767770676</image:loc>
      <image:title>Differentiated School Leadership</image:title>
      <image:caption>Book cover of: Differentiated School Leadership. By: Jane A. G Kise, Jane A. G. Kise</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-teacher-evaluation-and-professional-learning-springer-nature-switzerland-ag-9783030164539-policies-and-practices-for-promoting-career-growth-mary-lynne-derrington</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783030164539.jpg?v=1767770672</image:loc>
      <image:title>Differentiated Teacher Evaluation and Professional Learning</image:title>
      <image:caption>Book cover of: Differentiated Teacher Evaluation and Professional Learning. By: Mary Lynne Derrington</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1995-taylor-francis-ltd-9780728202566-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202566.jpg?v=1767770671</image:loc>
      <image:title>EGLR 1995</image:title>
      <image:caption>Book cover of: EGLR 1995. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-assessment-in-middle-and-high-school-english-and-social-studies-taylor-francis-ltd-9781596671119-sheryn-northey-waterman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781596671119.jpg?v=1767770672</image:loc>
      <image:title>Differentiating Assessment in Middle and High School English and Social Studies</image:title>
      <image:caption>Book cover of: Differentiating Assessment in Middle and High School English and Social Studies. By: Sheryn Northey Waterman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1998-taylor-francis-ltd-9780728203105-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203105.jpg?v=1767770673</image:loc>
      <image:title>EGLR 1998</image:title>
      <image:caption>Book cover of: EGLR 1998. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-for-the-young-child-sage-publications-inc-9781412975568-teaching-strategies-across-the-content-areas-prek-3-joan-f-smutny</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412975568.jpg?v=1767770673</image:loc>
      <image:title>Differentiating for the Young Child</image:title>
      <image:caption>Book cover of: Differentiating for the Young Child. By: Joan F. Smutny</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-school-leadership-sage-publications-inc-9781412917735-effective-collaboration-communication-and-change-through-personality-type-jane-a-g-kise-jane-a-g-kise</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412917735.jpg?v=1767770671</image:loc>
      <image:title>Differentiated School Leadership</image:title>
      <image:caption>Book cover of: Differentiated School Leadership. By: Jane A. G. Kise, Jane A. G Kise</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1996-taylor-francis-ltd-9780728202696-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202696.jpg?v=1767770672</image:loc>
      <image:title>EGLR 1996</image:title>
      <image:caption>Book cover of: EGLR 1996. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-by-readiness-taylor-francis-ltd-9781138435568-strategies-and-lesson-plans-for-tiered-instruction-grades-k-8-linda-allen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138435568.jpg?v=1767770675</image:loc>
      <image:title>Differentiating By Readiness</image:title>
      <image:caption>Book cover of: Differentiating By Readiness. By: Linda Allen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1997-taylor-francis-ltd-9780728202917-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202917.jpg?v=1767770673</image:loc>
      <image:title>EGLR 1997</image:title>
      <image:caption>Book cover of: EGLR 1997. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1994-taylor-francis-ltd-9780728202122-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202122.jpg?v=1767770671</image:loc>
      <image:title>EGLR 1994</image:title>
      <image:caption>Book cover of: EGLR 1994. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1994-taylor-francis-ltd-9780728202139-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202139.jpg?v=1767770671</image:loc>
      <image:title>EGLR 1994</image:title>
      <image:caption>Book cover of: EGLR 1994. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1992-taylor-francis-ltd-9780728201828-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201828.jpg?v=1767770673</image:loc>
      <image:title>EGLR 1992</image:title>
      <image:caption>Book cover of: EGLR 1992. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1992-taylor-francis-ltd-9780728201811-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201811.jpg?v=1767770671</image:loc>
      <image:title>EGLR 1992</image:title>
      <image:caption>Book cover of: EGLR 1992. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1999-taylor-francis-ltd-9780728203273-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728203273.jpg?v=1767770675</image:loc>
      <image:title>EGLR 1999</image:title>
      <image:caption>Book cover of: EGLR 1999. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1997-taylor-francis-ltd-9780728202900-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202900.jpg?v=1767770670</image:loc>
      <image:title>EGLR 1997</image:title>
      <image:caption>Book cover of: EGLR 1997. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-workforce-harvard-business-review-press-9781422104460-translating-talent-into-strategic-impact-brian-e-becker</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781422104460.jpg?v=1767770672</image:loc>
      <image:title>Differentiated Workforce</image:title>
      <image:caption>Book cover of: Differentiated Workforce. By: Brian E. Becker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1991-taylor-francis-ltd-9780728201712-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201712.jpg?v=1767770672</image:loc>
      <image:title>EGLR 1991</image:title>
      <image:caption>Book cover of: EGLR 1991. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-literacy-instruction-in-grades-4-and-5-second-edition-guilford-publications-9781462540815-strategies-and-resources-sharon-walpole</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781462540815.jpg?v=1767770672</image:loc>
      <image:title>Differentiated Literacy Instruction in Grades 4 and 5, Second Edition</image:title>
      <image:caption>Book cover of: Differentiated Literacy Instruction in Grades 4 and 5, Second Edition. By: Sharon Walpole</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-literacy-instruction-in-grades-4-and-5-second-edition-guilford-publications-9781462540853-strategies-and-resources-sharon-walpole</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781462540853.jpg?v=1767770673</image:loc>
      <image:title>Differentiated Literacy Instruction in Grades 4 and 5, Second Edition</image:title>
      <image:caption>Book cover of: Differentiated Literacy Instruction in Grades 4 and 5, Second Edition. By: Sharon Walpole</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-school-leadership-sage-publications-inc-9781412970501-facing-the-challenges-of-practice-daniel-linden-duke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412970501.jpg?v=1767770674</image:loc>
      <image:title>Differentiating School Leadership</image:title>
      <image:caption>Book cover of: Differentiating School Leadership. By: Daniel Linden Duke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1993-taylor-francis-ltd-9780728201927-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201927.jpg?v=1767770673</image:loc>
      <image:title>EGLR 1993</image:title>
      <image:caption>Book cover of: EGLR 1993. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-literacy-strategies-for-english-language-learners-grades-7-12-sage-publications-inc-9781412996471-gayle-gregory</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412996471.jpg?v=1767770673</image:loc>
      <image:title>Differentiated Literacy Strategies for English Language Learners, Grades 7–12</image:title>
      <image:caption>Book cover of: Differentiated Literacy Strategies for English Language Learners, Grades 7–12. By: Gayle Gregory</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-instructional-strategies-professional-learning-guide-sage-publications-inc-9781452291642-one-size-doesn-t-fit-all</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781452291642.jpg?v=1767770674</image:loc>
      <image:title>Differentiated Instructional Strategies Professional Learning Guide</image:title>
      <image:caption>Book cover of: Differentiated Instructional Strategies Professional Learning Guide</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-instructional-strategies-for-reading-in-the-content-areas-sage-publications-inc-9781412972307-chapman-carolyn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412972307.jpg?v=1767770675</image:loc>
      <image:title>Differentiated Instructional Strategies for Reading in the Content Areas</image:title>
      <image:caption>Book cover of: Differentiated Instructional Strategies for Reading in the Content Areas. By: Chapman, Carolyn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1990-taylor-francis-ltd-9780728201606-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201606.jpg?v=1767770674</image:loc>
      <image:title>EGLR 1990</image:title>
      <image:caption>Book cover of: EGLR 1990. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-instruction-using-technology-taylor-francis-ltd-9781930556836-a-guide-for-middle-hs-teachers-amy-benjamin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781930556836.jpg?v=1767770676</image:loc>
      <image:title>Differentiated Instruction Using Technology</image:title>
      <image:caption>Book cover of: Differentiated Instruction Using Technology. By: Amy Benjamin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-literacy-instruction-taylor-francis-inc-9781621590569-assessing-grouping-teaching-julie-w-ankrum</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781621590569.jpg?v=1767770674</image:loc>
      <image:title>Differentiated Literacy Instruction</image:title>
      <image:caption>Book cover of: Differentiated Literacy Instruction. By: Julie W. Ankrum</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1991-taylor-francis-ltd-9780728201705-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201705.jpg?v=1767770672</image:loc>
      <image:title>EGLR 1991</image:title>
      <image:caption>Book cover of: EGLR 1991. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1989-taylor-francis-ltd-9780728201378-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201378.jpg?v=1767770673</image:loc>
      <image:title>EGLR 1989</image:title>
      <image:caption>Book cover of: EGLR 1989. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-instruction-taylor-francis-ltd-9781930556393-a-guide-for-middle-and-high-school-teachers-amy-benjamin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781930556393.jpg?v=1767770672</image:loc>
      <image:title>Differentiated Instruction</image:title>
      <image:caption>Book cover of: Differentiated Instruction. By: Amy Benjamin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1993-taylor-francis-ltd-9780728201910-barry-denyer-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201910.jpg?v=1767770672</image:loc>
      <image:title>EGLR 1993</image:title>
      <image:caption>Book cover of: EGLR 1993. By: Barry Denyer-Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-countryside-taylor-francis-ltd-9781857288957</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781857288957.jpg?v=1767770675</image:loc>
      <image:title>Differentiated Countryside</image:title>
      <image:caption>Book cover of: Differentiated Countryside</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-cloze-prim-ed-publishing-9781864002126-activities-to-develop-reading-comprehension-lyn-couling-brown</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781864002126.jpg?v=1767770674</image:loc>
      <image:title>Differentiated Cloze</image:title>
      <image:caption>Book cover of: Differentiated Cloze. By: Lyn Couling-Brown</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1986-taylor-francis-ltd-9780728201019-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201019.jpg?v=1767770674</image:loc>
      <image:title>EGLR 1986</image:title>
      <image:caption>Book cover of: EGLR 1986. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-instructional-strategies-sage-publications-inc-9781452260983-one-size-doesn-t-fit-all-gayle-h-gregory</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781452260983.jpg?v=1767770674</image:loc>
      <image:title>Differentiated Instructional Strategies</image:title>
      <image:caption>Book cover of: Differentiated Instructional Strategies. By: Gayle H. Gregory</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-assessment-for-middle-and-high-school-classrooms-taylor-francis-ltd-9781138475717-deborah-blaz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138475717.jpg?v=1767770674</image:loc>
      <image:title>Differentiated Assessment for Middle and High School Classrooms</image:title>
      <image:caption>Book cover of: Differentiated Assessment for Middle and High School Classrooms. By: Deborah Blaz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-instructional-strategies-for-the-block-schedule-sage-publications-inc-9781412950961-gayle-gregory</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412950961.jpg?v=1767770677</image:loc>
      <image:title>Differentiated Instructional Strategies for the Block Schedule</image:title>
      <image:caption>Book cover of: Differentiated Instructional Strategies for the Block Schedule. By: Gayle Gregory</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1991-set-taylor-francis-ltd-9780728201699-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201699.jpg?v=1767770672</image:loc>
      <image:title>EGLR 1991 SET</image:title>
      <image:caption>Book cover of: EGLR 1991 SET. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-instruction-for-k-8-math-and-science-taylor-francis-ltd-9781596670716-ideas-activities-and-lesson-plans-mary-hamm</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781596670716.jpg?v=1767770673</image:loc>
      <image:title>Differentiated Instruction for K-8 Math and Science</image:title>
      <image:caption>Book cover of: Differentiated Instruction for K-8 Math and Science. By: Mary Hamm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-assessment-for-middle-and-high-school-classrooms-taylor-francis-ltd-9781596670778-deborah-blaz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781596670778.jpg?v=1767770674</image:loc>
      <image:title>Differentiated Assessment for Middle and High School Classrooms</image:title>
      <image:caption>Book cover of: Differentiated Assessment for Middle and High School Classrooms. By: Deborah Blaz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1988-taylor-francis-ltd-9780728201255-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201255.jpg?v=1767770676</image:loc>
      <image:title>EGLR 1988</image:title>
      <image:caption>Book cover of: EGLR 1988. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1990-taylor-francis-ltd-9780728201590-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201590.jpg?v=1767770675</image:loc>
      <image:title>EGLR 1990</image:title>
      <image:caption>Book cover of: EGLR 1990. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1989-taylor-francis-ltd-9780728201361-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201361.jpg?v=1767770673</image:loc>
      <image:title>EGLR 1989</image:title>
      <image:caption>Book cover of: EGLR 1989. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-instruction-for-k-8-math-and-science-taylor-francis-ltd-9781138435629-ideas-activities-and-lesson-plans-mary-hamm</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138435629.jpg?v=1767770675</image:loc>
      <image:title>Differentiated Instruction for K-8 Math and Science</image:title>
      <image:caption>Book cover of: Differentiated Instruction for K-8 Math and Science. By: Mary Hamm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-coaching-sage-publications-inc-9781506327754-a-framework-for-helping-educators-change-jane-a-g-kise</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781506327754.jpg?v=1767770676</image:loc>
      <image:title>Differentiated Coaching</image:title>
      <image:caption>Book cover of: Differentiated Coaching. By: Jane A. G. Kise</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1987-taylor-francis-ltd-9780728201125-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201125.jpg?v=1767770673</image:loc>
      <image:title>EGLR 1987</image:title>
      <image:caption>Book cover of: EGLR 1987. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1987-taylor-francis-ltd-9780728201118-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201118.jpg?v=1767770676</image:loc>
      <image:title>EGLR 1987</image:title>
      <image:caption>Book cover of: EGLR 1987. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1982-taylor-francis-ltd-9780728202375-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202375.jpg?v=1767770674</image:loc>
      <image:title>EGLR 1982</image:title>
      <image:caption>Book cover of: EGLR 1982. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-instructional-strategies-for-science-grades-k-8-sage-publications-inc-9781412916516-gayle-h-gregory-gayle-gregory</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412916516.jpg?v=1767770676</image:loc>
      <image:title>Differentiated Instructional Strategies for Science, Grades K-8</image:title>
      <image:caption>Book cover of: Differentiated Instructional Strategies for Science, Grades K-8. By: Gayle H. Gregory, Gayle Gregory</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1980-taylor-francis-ltd-9780728202320-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202320.jpg?v=1767770677</image:loc>
      <image:title>EGLR 1980</image:title>
      <image:caption>Book cover of: EGLR 1980. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1981-taylor-francis-ltd-9780728202351-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202351.jpg?v=1767770673</image:loc>
      <image:title>EGLR 1981</image:title>
      <image:caption>Book cover of: EGLR 1981. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1979-taylor-francis-ltd-9780728202283-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202283.jpg?v=1767770673</image:loc>
      <image:title>EGLR 1979</image:title>
      <image:caption>Book cover of: EGLR 1979. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-topology-and-general-equilibrium-with-complete-and-incomplete-markets-springer-verlag-new-york-inc-9781402072017-antonio-villanacci</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781402072017.jpg?v=1767770676</image:loc>
      <image:title>Differential Topology and General Equilibrium with Complete and Incomplete Markets</image:title>
      <image:caption>Book cover of: Differential Topology and General Equilibrium with Complete and Incomplete Markets. By: Antonio Villanacci</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1986-taylor-francis-ltd-9780728201026-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201026.jpg?v=1767770675</image:loc>
      <image:title>EGLR 1986</image:title>
      <image:caption>Book cover of: EGLR 1986. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1980-taylor-francis-ltd-9780728202313-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202313.jpg?v=1767770673</image:loc>
      <image:title>EGLR 1980</image:title>
      <image:caption>Book cover of: EGLR 1980. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiating-by-student-learning-preferences-taylor-francis-ltd-9781596670822-strategies-and-lesson-plans-joni-turville</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781596670822.jpg?v=1767770673</image:loc>
      <image:title>Differentiating By Student Learning Preferences</image:title>
      <image:caption>Book cover of: Differentiating By Student Learning Preferences. By: Joni Turville</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1985-taylor-francis-ltd-9780728200982-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728200982.jpg?v=1767770673</image:loc>
      <image:title>EGLR 1985</image:title>
      <image:caption>Book cover of: EGLR 1985. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-scanning-calorimetry-taylor-francis-inc-9781466591523-applications-in-fat-and-oil-technology-emma-chiavaro</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781466591523.jpg?v=1767770675</image:loc>
      <image:title>Differential Scanning Calorimetry</image:title>
      <image:caption>Book cover of: Differential Scanning Calorimetry. By: Emma Chiavaro</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-operators-on-manifolds-springer-verlag-berlin-and-heidelberg-gmbh-co-kg-9783642111136-lectures-given-at-a-summer-school-of-the-centro-internazionale-matematico-estivo-c-i-m-e-held-in-varenna-como-italy-august-24-september-2-1975-e-vesenttni</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783642111136.jpg?v=1767770674</image:loc>
      <image:title>Differential Operators on Manifolds</image:title>
      <image:caption>Book cover of: Differential Operators on Manifolds. By: E. Vesenttni</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1979-taylor-francis-ltd-9780728202290-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202290.jpg?v=1767770673</image:loc>
      <image:title>EGLR 1979</image:title>
      <image:caption>Book cover of: EGLR 1979. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1982-taylor-francis-ltd-9780728202382-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202382.jpg?v=1767770675</image:loc>
      <image:title>EGLR 1982</image:title>
      <image:caption>Book cover of: EGLR 1982. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiated-instruction-taylor-francis-ltd-9781930556553-a-guide-for-elementary-school-teachers-amy-benjamin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781930556553.jpg?v=1767770675</image:loc>
      <image:title>Differentiated Instruction</image:title>
      <image:caption>Book cover of: Differentiated Instruction. By: Amy Benjamin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1988-taylor-francis-ltd-9780728201248-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728201248.jpg?v=1767770675</image:loc>
      <image:title>EGLR 1988</image:title>
      <image:caption>Book cover of: EGLR 1988. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-manifolds-a-basic-approach-for-experimental-physicists-world-scientific-publishing-co-pte-ltd-9789814449564-paul-baillon</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814449564.jpg?v=1767770674</image:loc>
      <image:title>Differential Manifolds: A Basic Approach For Experimental Physicists</image:title>
      <image:caption>Book cover of: Differential Manifolds: A Basic Approach For Experimental Physicists. By: Paul Baillon</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1977-taylor-francis-ltd-9780728202221-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202221.jpg?v=1767770675</image:loc>
      <image:title>EGLR 1977</image:title>
      <image:caption>Book cover of: EGLR 1977. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-privacy-and-applications-springer-international-publishing-ag-9783319620022-tianqing-zhu</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783319620022.jpg?v=1767770676</image:loc>
      <image:title>Differential Privacy and Applications</image:title>
      <image:caption>Book cover of: Differential Privacy and Applications. By: Tianqing Zhu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-social-impacts-of-rural-resource-development-taylor-francis-ltd-9780367006310</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367006310.jpg?v=1767770673</image:loc>
      <image:title>Differential Social Impacts of Rural Resource Development</image:title>
      <image:caption>Book cover of: Differential Social Impacts of Rural Resource Development</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1978-taylor-francis-ltd-9780728202252-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202252.jpg?v=1767770675</image:loc>
      <image:title>EGLR 1978</image:title>
      <image:caption>Book cover of: EGLR 1978. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1985-taylor-francis-ltd-9780728200975-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728200975.jpg?v=1767770676</image:loc>
      <image:title>EGLR 1985</image:title>
      <image:caption>Book cover of: EGLR 1985. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-scanning-calorimetry-taylor-francis-ltd-9780367378066-applications-in-fat-and-oil-technology-emma-chiavaro</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367378066.jpg?v=1767770675</image:loc>
      <image:title>Differential Scanning Calorimetry</image:title>
      <image:caption>Book cover of: Differential Scanning Calorimetry. By: Emma Chiavaro</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-ion-mobility-spectrometry-taylor-francis-inc-9781420051063-nonlinear-ion-transport-and-fundamentals-of-faims-alexandre-a-shvartsburg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781420051063.jpg?v=1767770675</image:loc>
      <image:title>Differential Ion Mobility Spectrometry</image:title>
      <image:caption>Book cover of: Differential Ion Mobility Spectrometry. By: Alexandre A. Shvartsburg</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-rates-residual-information-sets-transactional-algebras-nova-science-publishers-inc-9781594548727-rodolfo-apreda</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781594548727.jpg?v=1767770676</image:loc>
      <image:title>Differential Rates, Residual Information Sets &amp; Transactional Algebras</image:title>
      <image:caption>Book cover of: Differential Rates, Residual Information Sets &amp; Transactional Algebras. By: Rodolfo Apreda</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1975-taylor-francis-ltd-9780728202177-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202177.jpg?v=1767770676</image:loc>
      <image:title>EGLR 1975</image:title>
      <image:caption>Book cover of: EGLR 1975. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1975-taylor-francis-ltd-9780728202160-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202160.jpg?v=1767770674</image:loc>
      <image:title>EGLR 1975</image:title>
      <image:caption>Book cover of: EGLR 1975. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-social-impacts-of-rural-resource-development-taylor-francis-ltd-9780367156183-pamela-d-elkind-savatsky</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367156183.jpg?v=1767770675</image:loc>
      <image:title>Differential Social Impacts of Rural Resource Development</image:title>
      <image:caption>Book cover of: Differential Social Impacts of Rural Resource Development. By: Pamela D. Elkind-Savatsky</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-of-three-dimensions-volume-2-cambridge-university-press-9781316606957-c-e-weatherburn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781316606957.jpg?v=1767770676</image:loc>
      <image:title>Differential Geometry of Three Dimensions: Volume 2</image:title>
      <image:caption>Book cover of: Differential Geometry of Three Dimensions: Volume 2. By: C. E. Weatherburn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egils-saga-viking-society-for-northern-research-9780903521543</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780903521543.jpg?v=1767770676</image:loc>
      <image:title>Egils Saga</image:title>
      <image:caption>Book cover of: Egils Saga</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-sheaves-and-connections-a-natural-approach-to-physical-geometry-world-scientific-publishing-co-pte-ltd-9789814719469-anastasios-mallios</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814719469.jpg?v=1767770677</image:loc>
      <image:title>Differential Sheaves And Connections: A Natural Approach To Physical Geometry</image:title>
      <image:caption>Book cover of: Differential Sheaves And Connections: A Natural Approach To Physical Geometry. By: Anastasios Mallios</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-of-three-dimensions-volume-1-cambridge-university-press-9781316603840-c-e-weatherburn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781316603840.jpg?v=1767770676</image:loc>
      <image:title>Differential Geometry of Three Dimensions: Volume 1</image:title>
      <image:caption>Book cover of: Differential Geometry of Three Dimensions: Volume 1. By: C. E. Weatherburn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-of-curves-and-surfaces-world-scientific-publishing-co-pte-ltd-9789814740234-masaaki-umehara</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814740234.jpg?v=1767770677</image:loc>
      <image:title>Differential Geometry Of Curves And Surfaces</image:title>
      <image:caption>Book cover of: Differential Geometry Of Curves And Surfaces. By: Masaaki Umehara</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-item-functioning-sage-publications-inc-9781412954945-steven-j-osterlind</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412954945.jpg?v=1767770678</image:loc>
      <image:title>Differential Item Functioning</image:title>
      <image:caption>Book cover of: Differential Item Functioning. By: Steven J. Osterlind</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-calculus-of-variations-and-their-applications-taylor-francis-ltd-9781138441705-george-m-rassias</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138441705.jpg?v=1767770675</image:loc>
      <image:title>Differential Geometry, Calculus of Variations, and Their Applications</image:title>
      <image:caption>Book cover of: Differential Geometry, Calculus of Variations, and Their Applications. By: George M. Rassias</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglises-de-constantinople-pindar-press-9780906175033</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780906175033.jpg?v=1767770679</image:loc>
      <image:title>Eglises de Constantinople</image:title>
      <image:caption>Book cover of: Eglises de Constantinople</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-and-topology-taylor-francis-inc-9781584882534-with-a-view-to-dynamical-systems-keith-burns</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781584882534.jpg?v=1767770677</image:loc>
      <image:title>Differential Geometry and Topology</image:title>
      <image:caption>Book cover of: Differential Geometry and Topology. By: Keith Burns</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egg-drop-penguin-random-house-children-s-uk-9780099432036-mini-grey</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780099432036.jpg?v=1767770676</image:loc>
      <image:title>Egg Drop</image:title>
      <image:caption>Book cover of: Egg Drop. By: Mini Grey          </image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1981-taylor-francis-ltd-9780728202344-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202344.jpg?v=1767770676</image:loc>
      <image:title>EGLR 1981</image:title>
      <image:caption>Book cover of: EGLR 1981. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-from-a-singularity-theory-viewpoint-world-scientific-publishing-co-pte-ltd-9789814590440-shyuichi-izumiya</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814590440.jpg?v=1767770678</image:loc>
      <image:title>Differential Geometry From A Singularity Theory Viewpoint</image:title>
      <image:caption>Book cover of: Differential Geometry From A Singularity Theory Viewpoint. By: Shyuichi Izumiya</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1976-taylor-francis-ltd-9780728202191-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202191.jpg?v=1767770676</image:loc>
      <image:title>EGLR 1976</image:title>
      <image:caption>Book cover of: EGLR 1976. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-applied-to-dynamical-systems-with-cd-rom-world-scientific-publishing-co-pte-ltd-9789814277143-jean-marc-ginoux</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814277143.jpg?v=1767770676</image:loc>
      <image:title>Differential Geometry Applied To Dynamical Systems (With Cd-rom)</image:title>
      <image:caption>Book cover of: Differential Geometry Applied To Dynamical Systems (With Cd-rom). By: Jean-Marc Ginoux</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-in-array-processing-imperial-college-press-9781860944222-athanassios-manikas</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781860944222.jpg?v=1767770676</image:loc>
      <image:title>Differential Geometry In Array Processing</image:title>
      <image:caption>Book cover of: Differential Geometry In Array Processing. By: Athanassios Manikas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eggman-s-apprentice-vintage-publishing-9780099422259-maurice-leitch</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780099422259.jpg?v=1767770679</image:loc>
      <image:title>Eggman&apos;s Apprentice</image:title>
      <image:caption>Book cover of: Eggman&apos;s Apprentice. By: Maurice Leitch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egg-incubation-cambridge-university-press-9780521390712-its-effects-on-embryonic-development-in-birds-and-reptiles</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521390712.jpg?v=1767770674</image:loc>
      <image:title>Egg Incubation</image:title>
      <image:caption>Book cover of: Egg Incubation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egg-bioscience-and-biotechnology-john-wiley-sons-inc-9780470039984-yoshinori-mine</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780470039984.jpg?v=1767770676</image:loc>
      <image:title>Egg Bioscience and Biotechnology</image:title>
      <image:caption>Book cover of: Egg Bioscience and Biotechnology. By: Yoshinori Mine</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eggheads-quizbook-2007-edition-transworld-publishers-ltd-9780552161367</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780552161367.jpg?v=1767770678</image:loc>
      <image:title>Eggheads Quizbook 2007 edition</image:title>
      <image:caption>Book cover of: Eggheads Quizbook 2007 edition</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egg-nest-harvard-university-press-9780674031722-rosamond-wolff-purcell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780674031722.jpg?v=1767770678</image:loc>
      <image:title>Egg &amp; Nest</image:title>
      <image:caption>Book cover of: Egg &amp; Nest. By: Rosamond Wolff Purcell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-and-tanaka-theory-differential-system-and-hypersurface-theory-proceedings-of-the-international-conference-mathematical-society-of-japan-9784864970839-toshihiro-shoda</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9784864970839.jpg?v=1767770676</image:loc>
      <image:title>Differential Geometry And Tanaka Theory - Differential System And Hypersurface Theory - Proceedings Of The International Conference</image:title>
      <image:caption>Book cover of: Differential Geometry And Tanaka Theory - Differential System And Hypersurface Theory - Proceedings Of The International Conference. By: Toshihiro Shoda</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egerton-version-of-mandeville-s-travels-oxford-university-press-9780199591060</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780199591060.jpg?v=1767770676</image:loc>
      <image:title>Egerton Version of Mandeville&apos;s Travels</image:title>
      <image:caption>Book cover of: Egerton Version of Mandeville&apos;s Travels</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egalitarian-thought-and-labour-politics-taylor-francis-ltd-9780415755832-retreating-visions-nick-ellison</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415755832.jpg?v=1767770676</image:loc>
      <image:title>Egalitarian Thought and Labour Politics</image:title>
      <image:caption>Book cover of: Egalitarian Thought and Labour Politics. By: Nick Ellison</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-games-and-control-theory-iii-taylor-francis-ltd-9781138403949-proceedings-of-the-third-kingston-conference-pan-tai-liu</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138403949.jpg?v=1767770677</image:loc>
      <image:title>Differential Games and Control Theory Iii</image:title>
      <image:caption>Book cover of: Differential Games and Control Theory Iii. By: Pan-Tai Liu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eglr-1977-taylor-francis-ltd-9780728202238-j-muir-watt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728202238.jpg?v=1767770677</image:loc>
      <image:title>EGLR 1977</image:title>
      <image:caption>Book cover of: EGLR 1977. By: J Muir Watt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egil-s-saga-penguin-books-ltd-9780140447705-anonymous</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780140447705.jpg?v=1767770675</image:loc>
      <image:title>Egil&apos;s Saga</image:title>
      <image:caption>Book cover of: Egil&apos;s Saga. By: Anonymous</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egg-incubation-cambridge-university-press-9780521612036-its-effects-on-embryonic-development-in-birds-and-reptiles</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521612036.jpg?v=1767770676</image:loc>
      <image:title>Egg Incubation</image:title>
      <image:caption>Book cover of: Egg Incubation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egg-nutrition-and-biotechnology-cabi-publishing-9780851993300</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780851993300.jpg?v=1767770678</image:loc>
      <image:title>Egg Nutrition and Biotechnology</image:title>
      <image:caption>Book cover of: Egg Nutrition and Biotechnology</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-springer-international-publishing-ag-9783319550824-connections-curvature-and-characteristic-classes-loring-w-tu</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783319550824.jpg?v=1767770677</image:loc>
      <image:title>Differential Geometry</image:title>
      <image:caption>Book cover of: Differential Geometry. By: Loring W. Tu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-and-physics-proceedings-of-the-23th-international-conference-of-differential-geometric-methods-in-theoretical-physics-world-scientific-publishing-co-pte-ltd-9789812703774</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789812703774.jpg?v=1767770678</image:loc>
      <image:title>Differential Geometry And Physics - Proceedings Of The 23th International Conference Of Differential Geometric Methods In Theoretical Physics</image:title>
      <image:caption>Book cover of: Differential Geometry And Physics - Proceedings Of The 23th International Conference Of Differential Geometric Methods In Theoretical Physics</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egalitarian-revolution-in-the-savanna-taylor-francis-ltd-9781138110632-the-origins-of-a-west-african-political-system-stephen-a-dueppen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138110632.jpg?v=1767770677</image:loc>
      <image:title>Egalitarian Revolution in the Savanna</image:title>
      <image:caption>Book cover of: Egalitarian Revolution in the Savanna. By: Stephen A. Dueppen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-in-array-processing-imperial-college-press-9781860944239-athanassios-manikas</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781860944239.jpg?v=1767770677</image:loc>
      <image:title>Differential Geometry In Array Processing</image:title>
      <image:caption>Book cover of: Differential Geometry In Array Processing. By: Athanassios Manikas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egalitarians-human-and-chimpanzee-cambridge-university-press-9780521018265-an-anthropological-view-of-social-organization</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521018265.jpg?v=1767770677</image:loc>
      <image:title>Egalitarians - Human and Chimpanzee</image:title>
      <image:caption>Book cover of: Egalitarians - Human and Chimpanzee</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egg-is-quiet-chronicle-books-9780811844284-dianna-hutts-aston</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780811844284.jpg?v=1767770677</image:loc>
      <image:title>Egg Is Quiet</image:title>
      <image:caption>Book cover of: Egg Is Quiet. By: Dianna Hutts Aston</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eggshells-harpercollins-publishers-9780008324407-caitriona-lally</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780008324407.jpg?v=1767770679</image:loc>
      <image:title>Eggshells</image:title>
      <image:caption>Book cover of: Eggshells. By: Caitriona Lally</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egg-dancing-bloomsbury-publishing-plc-9780747585268-liz-jensen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780747585268.jpg?v=1767770679</image:loc>
      <image:title>Egg Dancing</image:title>
      <image:caption>Book cover of: Egg Dancing. By: Liz Jensen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effortless-mindfulness-taylor-francis-ltd-9780415637312-genuine-mental-health-through-awakened-presence-lisa-dale-miller</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415637312.jpg?v=1767770678</image:loc>
      <image:title>Effortless Mindfulness</image:title>
      <image:caption>Book cover of: Effortless Mindfulness. By: Lisa Dale Miller</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egalitarian-moment-cambridge-university-press-9780521496650-asia-and-africa-1950-1980-d-a-low</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521496650.jpg?v=1767770678</image:loc>
      <image:title>Egalitarian Moment</image:title>
      <image:caption>Book cover of: Egalitarian Moment. By: D. A. Low</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-with-maxima-taylor-francis-ltd-9780367382827-drumi-d-bainov</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367382827.jpg?v=1767770679</image:loc>
      <image:title>Differential Equations with Maxima</image:title>
      <image:caption>Book cover of: Differential Equations with Maxima. By: Drumi D. Bainov</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effortless-mindfulness-taylor-francis-ltd-9780415637336-genuine-mental-health-through-awakened-presence-lisa-dale-miller</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415637336.jpg?v=1767770679</image:loc>
      <image:title>Effortless Mindfulness</image:title>
      <image:caption>Book cover of: Effortless Mindfulness. By: Lisa Dale Miller</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-an-introduction-to-basic-concepts-results-and-applications-world-scientific-publishing-co-pte-ltd-9789814335621-i-i-vrabie</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814335621.jpg?v=1767770679</image:loc>
      <image:title>Differential Equations: An Introduction To Basic Concepts, Results And Applications</image:title>
      <image:caption>Book cover of: Differential Equations: An Introduction To Basic Concepts, Results And Applications. By: I. I. Vrabie</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-and-its-applications-proceedings-of-the-10th-international-conference-on-dga2007-world-scientific-publishing-co-pte-ltd-9789812790606-international-conference-on-differential-geometry-and-applications-10th-2007-olomouc-czech-republic</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789812790606.jpg?v=1767770676</image:loc>
      <image:title>Differential Geometry And Its Applications - Proceedings Of The 10th International Conference On Dga2007</image:title>
      <image:caption>Book cover of: Differential Geometry And Its Applications - Proceedings Of The 10th International Conference On Dga2007. By: International Conference on Differential Geometry and Applications (10th 2007 Olomouc, Czech Republic)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egalitarian-thought-and-labour-politics-taylor-francis-ltd-9780415069724-retreating-visions</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415069724.jpg?v=1767770680</image:loc>
      <image:title>Egalitarian Thought and Labour Politics</image:title>
      <image:caption>Book cover of: Egalitarian Thought and Labour Politics</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effort-and-excellence-in-urban-classrooms-teachers-college-press-9780807742167-expecting-and-getting-success-with-all-students-h-dickson-corbett</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780807742167.jpg?v=1767770678</image:loc>
      <image:title>Effort and Excellence in Urban Classrooms</image:title>
      <image:caption>Book cover of: Effort and Excellence in Urban Classrooms. By: H. Dickson Corbett</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egalitarian-perspectives-cambridge-university-press-9780521450669-essays-in-philosophical-economics</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521450669.jpg?v=1767770678</image:loc>
      <image:title>Egalitarian Perspectives</image:title>
      <image:caption>Book cover of: Egalitarian Perspectives</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-with-matlab-taylor-francis-inc-9781466557079-exploration-applications-and-theory-mark-a-mckibben</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781466557079.jpg?v=1767770679</image:loc>
      <image:title>Differential Equations with MATLAB</image:title>
      <image:caption>Book cover of: Differential Equations with MATLAB. By: Mark A. McKibben</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egad-the-woman-in-white-samuel-french-ltd-9780573608704</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780573608704.jpg?v=1767770678</image:loc>
      <image:title>Egad, The Woman In White</image:title>
      <image:caption>Book cover of: Egad, The Woman In White</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-an-introduction-to-basic-concepts-results-and-applications-third-edition-world-scientific-publishing-co-pte-ltd-9789814759205-ioan-i-vrabie</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814759205.jpg?v=1767770683</image:loc>
      <image:title>Differential Equations: An Introduction To Basic Concepts, Results And Applications (Third Edition)</image:title>
      <image:caption>Book cover of: Differential Equations: An Introduction To Basic Concepts, Results And Applications (Third Edition). By: Ioan I. Vrabie</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egalitarian-moment-cambridge-university-press-9780521567657-asia-and-africa-1950-1980-d-a-low</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521567657.jpg?v=1767770677</image:loc>
      <image:title>Egalitarian Moment</image:title>
      <image:caption>Book cover of: Egalitarian Moment. By: D. A. Low</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eft-in-your-pocket-isy-grigg-9780993573606-tapping-into-emotional-freedom</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780993573606.jpg?v=1767770679</image:loc>
      <image:title>EFT in Your Pocket</image:title>
      <image:caption>Book cover of: EFT in Your Pocket</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-an-introduction-to-basic-concepts-results-and-applications-third-edition-world-scientific-publishing-co-pte-ltd-9789814749787-ioan-i-vrabie</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814749787.jpg?v=1767770680</image:loc>
      <image:title>Differential Equations: An Introduction To Basic Concepts, Results And Applications (Third Edition)</image:title>
      <image:caption>Book cover of: Differential Equations: An Introduction To Basic Concepts, Results And Applications (Third Edition). By: Ioan I. Vrabie</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-on-measures-and-functional-spaces-springer-nature-switzerland-ag-9783030033767-vassili-kolokoltsov</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783030033767.jpg?v=1767770680</image:loc>
      <image:title>Differential Equations on Measures and Functional Spaces</image:title>
      <image:caption>Book cover of: Differential Equations on Measures and Functional Spaces. By: Vassili Kolokoltsov</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-bifurcations-and-chaos-in-economics-world-scientific-publishing-co-pte-ltd-9789812563330</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789812563330.jpg?v=1767770679</image:loc>
      <image:title>Differential Equations, Bifurcations And Chaos In Economics</image:title>
      <image:caption>Book cover of: Differential Equations, Bifurcations And Chaos In Economics</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egalitarianism-and-the-generation-of-inequality-oxford-university-press-9780198286486</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780198286486.jpg?v=1767770677</image:loc>
      <image:title>Egalitarianism and the Generation of Inequality</image:title>
      <image:caption>Book cover of: Egalitarianism and the Generation of Inequality</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-geometry-proceedings-of-the-viii-international-colloquium-world-scientific-publishing-co-pte-ltd-9789814261166-international-colloquium-on-differential-geometry-8th-2008-santiago-de-compostela-spain</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814261166.jpg?v=1767770680</image:loc>
      <image:title>Differential Geometry - Proceedings Of The Viii International Colloquium</image:title>
      <image:caption>Book cover of: Differential Geometry - Proceedings Of The Viii International Colloquium. By: International Colloquium on Differential Geometry (8th 2008 Santiago de Compostela, Spain)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-with-boundary-value-problems-pearson-education-limited-9781292039152-pearson-new-international-edition-john-c-polking</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781292039152.jpg?v=1767770679</image:loc>
      <image:title>Differential Equations with Boundary Value Problems</image:title>
      <image:caption>Book cover of: Differential Equations with Boundary Value Problems. By: John C. Polking</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efina-seagull-books-london-ltd-9780857421708-no-lle-revaz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780857421708.jpg?v=1767770678</image:loc>
      <image:title>Efina</image:title>
      <image:caption>Book cover of: Efina. By: Noëlle Revaz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-forms-and-the-geometry-of-general-relativity-taylor-francis-inc-9781466510005-tevian-dray</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781466510005.jpg?v=1767770678</image:loc>
      <image:title>Differential Forms and the Geometry of General Relativity</image:title>
      <image:caption>Book cover of: Differential Forms and the Geometry of General Relativity. By: Tevian Dray</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-galois-theory-and-non-integrability-of-hamiltonian-systems-birkhauser-verlag-ag-9783034807203</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783034807203.jpg?v=1767770678</image:loc>
      <image:title>Differential Galois Theory and Non-Integrability of Hamiltonian Systems</image:title>
      <image:caption>Book cover of: Differential Galois Theory and Non-Integrability of Hamiltonian Systems</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-with-applications-and-historical-notes-taylor-francis-inc-9781498702591</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781498702591.jpg?v=1767770681</image:loc>
      <image:title>Differential Equations with Applications and Historical Notes</image:title>
      <image:caption>Book cover of: Differential Equations with Applications and Historical Notes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eg-property-handbook-taylor-francis-ltd-9780728204331-geoff-parsons</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780728204331.jpg?v=1767770679</image:loc>
      <image:title>EG Property Handbook</image:title>
      <image:caption>Book cover of: EG Property Handbook. By: Geoff Parsons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effort-taylor-francis-inc-9780805860108-a-behavioral-neuroscience-perspective-on-the-will-jay-schulkin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805860108.jpg?v=1767770680</image:loc>
      <image:title>Effort</image:title>
      <image:caption>Book cover of: Effort. By: Jay Schulkin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effort-based-approach-to-consonant-lenition-taylor-francis-ltd-9781138993389-robert-martin-kirchner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138993389.jpg?v=1767770679</image:loc>
      <image:title>Effort Based Approach to Consonant Lenition</image:title>
      <image:caption>Book cover of: Effort Based Approach to Consonant Lenition. By: Robert Martin Kirchner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effort-taylor-francis-inc-9780805860092-a-behavioral-neuroscience-perspective-on-the-will-jay-schulkin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805860092.jpg?v=1767770678</image:loc>
      <image:title>Effort</image:title>
      <image:caption>Book cover of: Effort. By: Jay Schulkin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efflorescence-and-the-discoloration-of-concrete-taylor-francis-ltd-9780863100116-p-russell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780863100116.jpg?v=1767770679</image:loc>
      <image:title>Efflorescence and the Discoloration of Concrete</image:title>
      <image:caption>Book cover of: Efflorescence and the Discoloration of Concrete. By: P. Russell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-and-linear-algebra-pearson-education-limited-9781292025131-pearson-new-international-edition-stephen-w-goode</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781292025131.jpg?v=1767770681</image:loc>
      <image:title>Differential Equations and Linear Algebra</image:title>
      <image:caption>Book cover of: Differential Equations and Linear Algebra. By: Stephen W. Goode</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effortless-experience-penguin-books-ltd-9780241003305-conquering-the-new-battleground-for-customer-loyalty</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780241003305.jpg?v=1767770679</image:loc>
      <image:title>Effortless Experience</image:title>
      <image:caption>Book cover of: Effortless Experience</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-in-banach-spaces-taylor-francis-ltd-9781138413214-giovanni-dore</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138413214.jpg?v=1767770677</image:loc>
      <image:title>Differential Equations in Banach Spaces</image:title>
      <image:caption>Book cover of: Differential Equations in Banach Spaces. By: Giovanni Dore</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effort-based-approach-to-consonant-lenition-taylor-francis-ltd-9780415937436-robert-kirchner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415937436.jpg?v=1767770678</image:loc>
      <image:title>Effort Based Approach to Consonant Lenition</image:title>
      <image:caption>Book cover of: Effort Based Approach to Consonant Lenition. By: Robert Kirchner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-as-models-in-science-and-engineering-world-scientific-publishing-co-pte-ltd-9789814656979-gregory-baker</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814656979.jpg?v=1767770679</image:loc>
      <image:title>Differential Equations As Models In Science And Engineering</image:title>
      <image:caption>Book cover of: Differential Equations As Models In Science And Engineering. By: Gregory Baker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efflorescence-of-caricature-1759-1838-taylor-francis-ltd-9780754665915</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780754665915.jpg?v=1767770677</image:loc>
      <image:title>Efflorescence of Caricature, 1759–1838</image:title>
      <image:caption>Book cover of: Efflorescence of Caricature, 1759–1838</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effie-duckworth-books-9780715641446-the-passionate-lives-of-effie-gray-john-ruskin-and-john-everett-millais-suzanne-fagence-cooper</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780715641446.jpg?v=1767770680</image:loc>
      <image:title>Effie</image:title>
      <image:caption>Book cover of: Effie. By: Suzanne Fagence Cooper</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-as-models-in-science-and-engineering-world-scientific-publishing-co-pte-ltd-9789814656962-gregory-baker</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814656962.jpg?v=1767770679</image:loc>
      <image:title>Differential Equations As Models In Science And Engineering</image:title>
      <image:caption>Book cover of: Differential Equations As Models In Science And Engineering. By: Gregory Baker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-with-maxima-taylor-francis-inc-9781439867570-d-ba-nov</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781439867570.jpg?v=1767770678</image:loc>
      <image:title>Differential Equations with Maxima</image:title>
      <image:caption>Book cover of: Differential Equations with Maxima. By: D. Baĭnov</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-evolution-in-chemical-engineering-developments-and-applications-world-scientific-publishing-co-pte-ltd-9789813207516-gade-pandu-rangaiah</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789813207516.jpg?v=1767770678</image:loc>
      <image:title>Differential Evolution In Chemical Engineering: Developments And Applications</image:title>
      <image:caption>Book cover of: Differential Evolution In Chemical Engineering: Developments And Applications. By: Gade Pandu Rangaiah</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-with-applications-in-biology-physics-and-engineering-taylor-francis-ltd-9781138417755-goldstein</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138417755.jpg?v=1767770680</image:loc>
      <image:title>Differential Equations with Applications in Biology, Physics, and Engineering</image:title>
      <image:caption>Book cover of: Differential Equations with Applications in Biology, Physics, and Engineering. By: Goldstein</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-applications-volume-1-nova-science-publishers-inc-9781560727675-international-conference-on-mathematical-analysis-and-applications-1st-1998-kyongsang-taehak</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781560727675.jpg?v=1767770680</image:loc>
      <image:title>Differential Equations &amp; Applications, Volume 1</image:title>
      <image:caption>Book cover of: Differential Equations &amp; Applications, Volume 1. By: International Conference on Mathematical Analysis and Applications (1st : 1998 : Kyongsang Taehak)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effie-s-burning-samuel-french-ltd-9780573132360-valerie-windsor</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780573132360.jpg?v=1767770681</image:loc>
      <image:title>Effie&apos;s Burning</image:title>
      <image:caption>Book cover of: Effie&apos;s Burning. By: Valerie Windsor</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-applications-volume-3-nova-science-publishers-inc-9781590338599</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781590338599.jpg?v=1767770680</image:loc>
      <image:title>Differential Equations &amp; Applications, Volume 3</image:title>
      <image:caption>Book cover of: Differential Equations &amp; Applications, Volume 3</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-and-mathematical-biology-taylor-francis-ltd-9781420083576-d-s-jones</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781420083576.jpg?v=1767770682</image:loc>
      <image:title>Differential Equations and Mathematical Biology</image:title>
      <image:caption>Book cover of: Differential Equations and Mathematical Biology. By: D. S. Jones</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-mathematical-modelling-nova-science-publishers-inc-9781590330852-a-m-blokhin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781590330852.jpg?v=1767770678</image:loc>
      <image:title>Differential Equations &amp; Mathematical Modelling</image:title>
      <image:caption>Book cover of: Differential Equations &amp; Mathematical Modelling. By: A. M. Blokhin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficient-secret-cambridge-university-press-9780521019019-the-cabinet-and-the-development-of-political-parties-in-victorian-england-gary-w-cox</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521019019.jpg?v=1767770680</image:loc>
      <image:title>Efficient Secret</image:title>
      <image:caption>Book cover of: Efficient Secret. By: Gary W. Cox</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficient-transportation-and-pavement-systems-characterization-mechanisms-simulation-and-modeling-taylor-francis-ltd-9780415489799</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415489799.jpg?v=1767770682</image:loc>
      <image:title>Efficient Transportation and Pavement Systems: Characterization, Mechanisms, Simulation, and Modeling</image:title>
      <image:caption>Book cover of: Efficient Transportation and Pavement Systems: Characterization, Mechanisms, Simulation, and Modeling</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/egalitarianism-taylor-francis-ltd-9780415783187-iwao-hirose</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415783187.jpg?v=1767770679</image:loc>
      <image:title>Egalitarianism</image:title>
      <image:caption>Book cover of: Egalitarianism. By: Iwao Hirose</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficient-parallel-algorithms-cambridge-university-press-9780521388412-gibbons-alan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521388412.jpg?v=1767770680</image:loc>
      <image:title>Efficient Parallel Algorithms</image:title>
      <image:caption>Book cover of: Efficient Parallel Algorithms. By: Gibbons, Alan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-applications-volume-4-nova-science-publishers-inc-9781594548765-yeol-je-cho</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781594548765.jpg?v=1767770680</image:loc>
      <image:title>Differential Equations &amp; Applications, Volume 4</image:title>
      <image:caption>Book cover of: Differential Equations &amp; Applications, Volume 4. By: Yeol Je Cho</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-driven-by-rough-paths-springer-verlag-berlin-and-heidelberg-gmbh-co-kg-9783540712848-ecole-d-ete-de-probabilites-de-saint-flour-xxxiv-2004-terry-j-lyons</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783540712848.jpg?v=1767770678</image:loc>
      <image:title>Differential Equations Driven by Rough Paths</image:title>
      <image:caption>Book cover of: Differential Equations Driven by Rough Paths. By: Terry J. Lyons</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficient-algorithms-for-listing-combinatorial-structures-cambridge-university-press-9780521117883-leslie-ann-goldberg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521117883.jpg?v=1767770682</image:loc>
      <image:title>Efficient Algorithms for Listing Combinatorial Structures</image:title>
      <image:caption>Book cover of: Efficient Algorithms for Listing Combinatorial Structures. By: Leslie Ann Goldberg</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-applications-volume-5-nova-science-publishers-inc-9781594548789-yeol-je-cho</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781594548789.jpg?v=1767770682</image:loc>
      <image:title>Differential Equations &amp; Applications, Volume 5</image:title>
      <image:caption>Book cover of: Differential Equations &amp; Applications, Volume 5. By: Yeol Je Cho</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-for-engineers-taylor-francis-inc-9781498798815-the-essentials-david-v-kalbaugh</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781498798815.jpg?v=1767770679</image:loc>
      <image:title>Differential Equations for Engineers</image:title>
      <image:caption>Book cover of: Differential Equations for Engineers. By: David V. Kalbaugh</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-finance-and-varieties-of-industrial-policy-columbia-university-press-9780231180504-guiding-resources-learning-and-technology-for-sustained-growth-akbar-noman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780231180504.jpg?v=1767770681</image:loc>
      <image:title>Efficiency, Finance, and Varieties of Industrial Policy</image:title>
      <image:caption>Book cover of: Efficiency, Finance, and Varieties of Industrial Policy. By: Akbar Noman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-applications-volume-2-nova-science-publishers-inc-9781590331774</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781590331774.jpg?v=1767770680</image:loc>
      <image:title>Differential Equations &amp; Applications, Volume 2</image:title>
      <image:caption>Book cover of: Differential Equations &amp; Applications, Volume 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-equality-and-the-ownership-of-property-routledge-revivals-taylor-francis-ltd-9780415621731-james-e-meade</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415621731.jpg?v=1767770680</image:loc>
      <image:title>Efficiency, Equality and the Ownership of Property (Routledge Revivals)</image:title>
      <image:caption>Book cover of: Efficiency, Equality and the Ownership of Property (Routledge Revivals). By: James E. Meade</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effigy-bloomsbury-publishing-plc-9780739125526-images-of-capital-defendants-allison-m-cotton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780739125526.jpg?v=1767770682</image:loc>
      <image:title>Effigy</image:title>
      <image:caption>Book cover of: Effigy. By: Allison M. Cotton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficient-and-adaptive-estimation-for-semiparametric-models-springer-verlag-new-york-inc-9780387984735</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780387984735.jpg?v=1767770680</image:loc>
      <image:title>Efficient and Adaptive Estimation for Semiparametric Models</image:title>
      <image:caption>Book cover of: Efficient and Adaptive Estimation for Semiparametric Models</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-wages-princeton-university-press-9780691608907-models-of-unemployment-layoffs-and-wage-dispersion-andrew-weiss</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780691608907.jpg?v=1767770678</image:loc>
      <image:title>Efficiency Wages</image:title>
      <image:caption>Book cover of: Efficiency Wages. By: Andrew Weiss</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-springer-international-publishing-ag-9783319843506-a-primer-for-scientists-and-engineers-christian-constanda</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783319843506.jpg?v=1767770680</image:loc>
      <image:title>Differential Equations</image:title>
      <image:caption>Book cover of: Differential Equations. By: Christian Constanda</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-taylor-francis-inc-9781498735018-theory-technique-and-practice-with-boundary-value-problems-steven-g-krantz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781498735018.jpg?v=1767770681</image:loc>
      <image:title>Differential Equations</image:title>
      <image:caption>Book cover of: Differential Equations. By: Steven G. Krantz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-springer-international-publishing-ag-9783319452609-viorel-barbu</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783319452609.jpg?v=1767770680</image:loc>
      <image:title>Differential Equations</image:title>
      <image:caption>Book cover of: Differential Equations. By: Viorel Barbu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-sage-publications-inc-9781412941082-a-modeling-approach-courtney-brown</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412941082.jpg?v=1767770682</image:loc>
      <image:title>Differential Equations</image:title>
      <image:caption>Book cover of: Differential Equations. By: Courtney Brown</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficient-multirate-teletraffic-loss-models-beyond-erlang-john-wiley-sons-inc-9781119426882-michael-d-logothetis</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781119426882.jpg?v=1767770680</image:loc>
      <image:title>Efficient Multirate Teletraffic Loss Models Beyond Erlang</image:title>
      <image:caption>Book cover of: Efficient Multirate Teletraffic Loss Models Beyond Erlang. By: Michael D. Logothetis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-springer-nature-switzerland-ag-9783030205058-for-scientists-and-engineers-allan-struthers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783030205058.jpg?v=1767770682</image:loc>
      <image:title>Differential Equations</image:title>
      <image:caption>Book cover of: Differential Equations. By: Allan Struthers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-equality-and-the-ownership-of-property-routledge-revivals-taylor-francis-ltd-9780415526265-james-e-meade</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415526265.jpg?v=1767770683</image:loc>
      <image:title>Efficiency, Equality and the Ownership of Property (Routledge Revivals)</image:title>
      <image:caption>Book cover of: Efficiency, Equality and the Ownership of Property (Routledge Revivals). By: James E. Meade</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-wage-models-of-the-labor-market-cambridge-university-press-9780521312844</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521312844.jpg?v=1767770681</image:loc>
      <image:title>Efficiency Wage Models of the Labor Market</image:title>
      <image:caption>Book cover of: Efficiency Wage Models of the Labor Market</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-and-dynamical-systems-springer-nature-switzerland-ag-9783030131807-2-usuzcamp-urgench-uzbekistan-august-8-12-2017-abdulla-azamov</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783030131807.jpg?v=1767770681</image:loc>
      <image:title>Differential Equations and Dynamical Systems</image:title>
      <image:caption>Book cover of: Differential Equations and Dynamical Systems. By: Abdulla Azamov</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-gordon-breach-science-publishers-sa-9782881249792-o-a-oleinik</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9782881249792.jpg?v=1767770682</image:loc>
      <image:title>Differential Equations</image:title>
      <image:caption>Book cover of: Differential Equations. By: O.A. Oleinik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-wages-princeton-university-press-9780691637273-models-of-unemployment-layoffs-and-wage-dispersion-andrew-weiss</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780691637273.jpg?v=1767770681</image:loc>
      <image:title>Efficiency Wages</image:title>
      <image:caption>Book cover of: Efficiency Wages. By: Andrew Weiss</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-of-hyperthyroidism-nova-science-publishers-inc-9781616682422-mehtap-cakir</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781616682422.jpg?v=1767770682</image:loc>
      <image:title>Differential Diagnosis of Hyperthyroidism</image:title>
      <image:caption>Book cover of: Differential Diagnosis of Hyperthyroidism. By: Mehtap Cakir</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-of-social-sector-expenditure-in-india-taylor-francis-ltd-9781138056121-brijesh-c-purohit</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138056121.jpg?v=1767770680</image:loc>
      <image:title>Efficiency of Social Sector Expenditure in India</image:title>
      <image:caption>Book cover of: Efficiency of Social Sector Expenditure in India. By: Brijesh C. Purohit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-of-social-sector-expenditure-in-india-taylor-francis-ltd-9780415736268-brijesh-c-purohit</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415736268.jpg?v=1767770681</image:loc>
      <image:title>Efficiency of Social Sector Expenditure in India</image:title>
      <image:caption>Book cover of: Efficiency of Social Sector Expenditure in India. By: Brijesh C. Purohit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-of-movement-disorders-in-clinical-practice-springer-international-publishing-ag-9783319016061</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783319016061.jpg?v=1767770682</image:loc>
      <image:title>Differential Diagnosis of Movement Disorders in Clinical Practice</image:title>
      <image:caption>Book cover of: Differential Diagnosis of Movement Disorders in Clinical Practice</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-john-wiley-sons-inc-9781119657637-an-introduction-to-modern-methods-and-applications-emea-edition</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781119657637.jpg?v=1767770685</image:loc>
      <image:title>Differential Equations</image:title>
      <image:caption>Book cover of: Differential Equations</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-taylor-francis-ltd-9781138501607-a-problem-solving-approach-based-on-matlab-p-mohana-shankar</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138501607.jpg?v=1767770682</image:loc>
      <image:title>Differential Equations</image:title>
      <image:caption>Book cover of: Differential Equations. By: P. Mohana Shankar</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efflorescence-of-caricature-1759-1838-taylor-francis-ltd-9781138248298-todd-porterfield</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138248298.jpg?v=1767770684</image:loc>
      <image:title>Efflorescence of Caricature, 1759–1838</image:title>
      <image:caption>Book cover of: Efflorescence of Caricature, 1759–1838. By: Todd Porterfield</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-measurement-in-health-and-health-care-taylor-francis-ltd-9780415569491-bruce-hollingsworth</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415569491.jpg?v=1767770683</image:loc>
      <image:title>Efficiency Measurement in Health and Health Care</image:title>
      <image:caption>Book cover of: Efficiency Measurement in Health and Health Care. By: Bruce Hollingsworth</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-pediatric-imaging-thieme-publishing-group-9783131437112-rick-r-van-rijn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783131437112.jpg?v=1767770682</image:loc>
      <image:title>Differential Diagnosis in Pediatric Imaging</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Pediatric Imaging. By: Rick R. van Rijn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-taylor-francis-inc-9781584886044-inverse-and-direct-problems</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781584886044.jpg?v=1767770680</image:loc>
      <image:title>Differential Equations</image:title>
      <image:caption>Book cover of: Differential Equations</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-otolaryngology-thieme-medical-publishers-inc-9781604060515-head-and-neck-surgery-michael-g-stewart</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781604060515.jpg?v=1767770682</image:loc>
      <image:title>Differential Diagnosis in Otolaryngology</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Otolaryngology. By: Michael G. Stewart</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-measurement-in-health-and-health-care-taylor-francis-ltd-9780415271370-bruce-hollingsworth-hollingsworth</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415271370.jpg?v=1767770682</image:loc>
      <image:title>Efficiency Measurement in Health and Health Care</image:title>
      <image:caption>Book cover of: Efficiency Measurement in Health and Health Care. By: Bruce Hollingsworth, Hollingsworth</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-equations-taylor-francis-ltd-9780367444099-a-modern-approach-with-wavelets-steven-krantz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367444099.jpg?v=1767770683</image:loc>
      <image:title>Differential Equations</image:title>
      <image:caption>Book cover of: Differential Equations. By: Steven Krantz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-criteria-for-nationalised-industries-routledge-revivals-taylor-francis-ltd-9780415682435-alec-nove</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415682435.jpg?v=1767770682</image:loc>
      <image:title>Efficiency Criteria for Nationalised Industries (Routledge Revivals)</image:title>
      <image:caption>Book cover of: Efficiency Criteria for Nationalised Industries (Routledge Revivals). By: Alec Nove</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-criteria-for-nationalised-industries-routledge-revivals-taylor-francis-ltd-9780415683531-alec-nove</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415683531.jpg?v=1767770681</image:loc>
      <image:title>Efficiency Criteria for Nationalised Industries (Routledge Revivals)</image:title>
      <image:caption>Book cover of: Efficiency Criteria for Nationalised Industries (Routledge Revivals). By: Alec Nove</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-of-china-s-stock-market-taylor-francis-inc-9780815397700-shiguang-ma</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815397700.jpg?v=1767770680</image:loc>
      <image:title>Efficiency of China&apos;s Stock Market</image:title>
      <image:caption>Book cover of: Efficiency of China&apos;s Stock Market. By: Shiguang Ma</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-and-management-taylor-francis-ltd-9780415541237-guy-callender</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415541237.jpg?v=1767770684</image:loc>
      <image:title>Efficiency and Management</image:title>
      <image:caption>Book cover of: Efficiency and Management. By: Guy Callender</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-pediatric-dermatology-springer-verlag-9788847028586-ernesto-bonifazi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9788847028586.jpg?v=1767770683</image:loc>
      <image:title>Differential Diagnosis in Pediatric Dermatology</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Pediatric Dermatology. By: Ernesto Bonifazi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-neuroimaging-spine-thieme-medical-publishers-inc-9781626234772-steven-p-meyers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781626234772.jpg?v=1767770685</image:loc>
      <image:title>Differential Diagnosis in Neuroimaging: Spine</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Neuroimaging: Spine. By: Steven P. Meyers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-and-economy-in-animal-physiology-cambridge-university-press-9780521019064-robert-w-blake</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521019064.jpg?v=1767770682</image:loc>
      <image:title>Efficiency and Economy in Animal Physiology</image:title>
      <image:caption>Book cover of: Efficiency and Economy in Animal Physiology. By: Robert W. Blake</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficacious-landscape-harvard-university-asia-center-9780674417151-on-the-authorities-of-painting-at-the-northern-song-court-ping-foong</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780674417151.jpg?v=1767770682</image:loc>
      <image:title>Efficacious Landscape</image:title>
      <image:caption>Book cover of: Efficacious Landscape. By: Ping Foong</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficacy-of-architecture-taylor-francis-ltd-9781138909854-political-contestation-and-agency-tahl-kaminer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138909854.jpg?v=1767770682</image:loc>
      <image:title>Efficacy of Architecture</image:title>
      <image:caption>Book cover of: Efficacy of Architecture. By: Tahl Kaminer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-pediatric-dermatology-springer-verlag-9788847039346-ernesto-bonifazi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9788847039346.jpg?v=1767770686</image:loc>
      <image:title>Differential Diagnosis in Pediatric Dermatology</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Pediatric Dermatology. By: Ernesto Bonifazi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-neurology-and-neurosurgery-thieme-publishing-group-9783132417182-a-clinician-s-pocket-guide-sotirios-a-tsementzis</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783132417182.jpg?v=1767770686</image:loc>
      <image:title>Differential Diagnosis in Neurology and Neurosurgery</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Neurology and Neurosurgery. By: Sotirios A. Tsementzis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-and-management-taylor-francis-ltd-9780415431804-guy-callender</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415431804.jpg?v=1767770682</image:loc>
      <image:title>Efficiency and Management</image:title>
      <image:caption>Book cover of: Efficiency and Management. By: Guy Callender</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-general-medicine-legend-press-ltd-9781908684394-ahran-arnold</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781908684394.jpg?v=1767770682</image:loc>
      <image:title>Differential Diagnosis in General Medicine</image:title>
      <image:caption>Book cover of: Differential Diagnosis in General Medicine. By: Ahran Arnold</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-and-effort-taylor-francis-ltd-9780415264365-an-analysis-of-industrial-administration-w-baldamus</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415264365.jpg?v=1767770682</image:loc>
      <image:title>Efficiency and Effort</image:title>
      <image:caption>Book cover of: Efficiency and Effort. By: W. Baldamus</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-musculoskeletal-mr-thieme-medical-publishers-inc-9781604066838-gary-m-hollenberg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781604066838.jpg?v=1767770683</image:loc>
      <image:title>Differential Diagnosis in Musculoskeletal MR</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Musculoskeletal MR. By: Gary M. Hollenberg</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-ultrasound-imaging-thieme-publishing-group-9783131318923-guenter-schmidt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783131318923.jpg?v=1767770683</image:loc>
      <image:title>Differential Diagnosis in Ultrasound Imaging</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Ultrasound Imaging. By: Guenter Schmidt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-dermatology-jp-medical-ltd-9781909836198-klaus-f-helm</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781909836198.jpg?v=1767770684</image:loc>
      <image:title>Differential Diagnosis in Dermatology</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Dermatology. By: Klaus F. Helm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-of-biomass-energy-john-wiley-sons-inc-9781118702109-an-exergy-approach-to-biofuels-power-and-biorefineries-krzysztof-j-ptasinski</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781118702109.jpg?v=1767770684</image:loc>
      <image:title>Efficiency of Biomass Energy</image:title>
      <image:caption>Book cover of: Efficiency of Biomass Energy. By: Krzysztof J. Ptasinski</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-the-eurozone-sovereign-debt-crisis-taylor-francis-ltd-9781138851092-differentiated-integration-between-the-centre-and-the-new-peripheries-of-the-eu-christian-schweiger</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138851092.jpg?v=1767770683</image:loc>
      <image:title>Effects of the Eurozone Sovereign Debt Crisis</image:title>
      <image:caption>Book cover of: Effects of the Eurozone Sovereign Debt Crisis. By: Christian Schweiger</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficacy-of-architecture-taylor-francis-ltd-9781138909861-political-contestation-and-agency-tahl-kaminer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138909861.jpg?v=1767770684</image:loc>
      <image:title>Efficacy of Architecture</image:title>
      <image:caption>Book cover of: Efficacy of Architecture. By: Tahl Kaminer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-neuroimaging-head-and-neck-thieme-medical-publishers-inc-9781626234758-steven-p-meyers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781626234758.jpg?v=1767770686</image:loc>
      <image:title>Differential Diagnosis in Neuroimaging: Head and Neck</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Neuroimaging: Head and Neck. By: Steven P. Meyers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-and-effort-taylor-francis-ltd-9780415865968-an-analysis-of-industrial-administration-w-baldamus</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415865968.jpg?v=1767770684</image:loc>
      <image:title>Efficiency and Effort</image:title>
      <image:caption>Book cover of: Efficiency and Effort. By: W. Baldamus</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnoses-in-surgical-pathology-head-and-neck-lippincott-williams-and-wilkins-9781496309792-william-h-westra-md</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781496309792.jpg?v=1767770684</image:loc>
      <image:title>Differential Diagnoses in Surgical Pathology: Head and Neck</image:title>
      <image:caption>Book cover of: Differential Diagnoses in Surgical Pathology: Head and Neck. By: William H. Westra MD</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-smoking-on-the-fetus-neonate-and-child-oxford-university-press-9780192622600</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780192622600.jpg?v=1767770684</image:loc>
      <image:title>Effects of Smoking on the Fetus, Neonate and Child</image:title>
      <image:caption>Book cover of: Effects of Smoking on the Fetus, Neonate and Child</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effi-briest-oxford-university-press-9780199675647</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780199675647.jpg?v=1767770685</image:loc>
      <image:title>Effi Briest</image:title>
      <image:caption>Book cover of: Effi Briest</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-internal-medicine-thieme-publishing-group-9783131421418-from-symptom-to-diagnosis-walter-siegenthaler</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783131421418.jpg?v=1767770683</image:loc>
      <image:title>Differential Diagnosis in Internal Medicine</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Internal Medicine. By: Walter Siegenthaler</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-travel-and-tourism-on-california-s-economy-rand-9780833097361-a-labor-market-focused-analysis-matthew-d-baird</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780833097361.jpg?v=1767770688</image:loc>
      <image:title>Effects of Travel and Tourism on California&apos;s Economy</image:title>
      <image:caption>Book cover of: Effects of Travel and Tourism on California&apos;s Economy. By: Matthew D. Baird</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-computed-tomography-thieme-publishing-group-9783131025425-francis-a-burgener</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783131025425.jpg?v=1767770685</image:loc>
      <image:title>Differential Diagnosis in Computed Tomography</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Computed Tomography. By: Francis A. Burgener</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-neuroimaging-brain-and-meninges-thieme-medical-publishers-inc-9781604067002-steven-p-meyers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781604067002.jpg?v=1767770684</image:loc>
      <image:title>Differential Diagnosis in Neuroimaging: Brain and Meninges</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Neuroimaging: Brain and Meninges. By: Steven P. Meyers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-uv-radiation-in-the-marine-environment-cambridge-university-press-9780521632188-s-j-de-mora</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521632188.jpg?v=1767770683</image:loc>
      <image:title>Effects of UV Radiation in the Marine Environment</image:title>
      <image:caption>Book cover of: Effects of UV Radiation in the Marine Environment. By: S.J. de Mora</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-receiving-country-policies-on-migration-flows-taylor-francis-ltd-9780367291648</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367291648.jpg?v=1767770683</image:loc>
      <image:title>Effects Of Receiving Country Policies On Migration Flows</image:title>
      <image:caption>Book cover of: Effects Of Receiving Country Policies On Migration Flows</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-the-eurozone-sovereign-debt-crisis-taylor-francis-ltd-9781138057494-differentiated-integration-between-the-centre-and-the-new-peripheries-of-the-eu-christian-schweiger</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138057494.jpg?v=1767770683</image:loc>
      <image:title>Effects of the Eurozone Sovereign Debt Crisis</image:title>
      <image:caption>Book cover of: Effects of the Eurozone Sovereign Debt Crisis. By: Christian Schweiger</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-third-party-bad-faith-doctrine-on-automobile-insurance-costs-and-compensation-rand-9780833030344-angela-hawken</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780833030344.jpg?v=1767770686</image:loc>
      <image:title>Effects of Third-party Bad Faith Doctrine on Automobile Insurance Costs and Compensation</image:title>
      <image:caption>Book cover of: Effects of Third-party Bad Faith Doctrine on Automobile Insurance Costs and Compensation. By: Angela Hawken</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-and-treatment-in-primary-care-lippincott-williams-and-wilkins-9781496374950-dr-r-douglas-collins-md</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781496374950.jpg?v=1767770688</image:loc>
      <image:title>Differential Diagnosis and Treatment in Primary Care</image:title>
      <image:caption>Book cover of: Differential Diagnosis and Treatment in Primary Care. By: Dr. R. Douglas Collins MD</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-music-taylor-francis-ltd-9780415209731-a-series-of-essays-max-schoen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415209731.jpg?v=1767770684</image:loc>
      <image:title>Effects of Music</image:title>
      <image:caption>Book cover of: Effects of Music. By: Max Schoen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-uv-radiation-in-the-marine-environment-cambridge-university-press-9780521020954</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521020954.jpg?v=1767770685</image:loc>
      <image:title>Effects of UV Radiation in the Marine Environment</image:title>
      <image:caption>Book cover of: Effects of UV Radiation in the Marine Environment</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-calculas-in-normed-linear-spaces-hindustan-book-agency-9788185931760-kalyan-mukherjea</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9788185931760.jpg?v=1767770684</image:loc>
      <image:title>Differential Calculas in Normed Linear Spaces</image:title>
      <image:caption>Book cover of: Differential Calculas in Normed Linear Spaces. By: Kalyan Mukherjea</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-psychotherapy-with-children-and-adolescents-sage-publications-inc-9780803943896</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780803943896.jpg?v=1767770685</image:loc>
      <image:title>Effects of Psychotherapy with Children and Adolescents</image:title>
      <image:caption>Book cover of: Effects of Psychotherapy with Children and Adolescents</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/efficiency-and-economy-in-animal-physiology-cambridge-university-press-9780521400664</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521400664.jpg?v=1767770685</image:loc>
      <image:title>Efficiency and Economy in Animal Physiology</image:title>
      <image:caption>Book cover of: Efficiency and Economy in Animal Physiology</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-sound-on-people-john-wiley-sons-inc-9781118895702-james-p-cowan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781118895702.jpg?v=1767770686</image:loc>
      <image:title>Effects of Sound on People</image:title>
      <image:caption>Book cover of: Effects of Sound on People. By: James P. Cowan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnoses-in-surgical-pathology-gastrointestinal-system-lippincott-williams-and-wilkins-9781451191899-elizabeth-a-montgomery</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781451191899.jpg?v=1767770689</image:loc>
      <image:title>Differential Diagnoses in Surgical Pathology: Gastrointestinal System</image:title>
      <image:caption>Book cover of: Differential Diagnoses in Surgical Pathology: Gastrointestinal System. By: Elizabeth A. Montgomery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-music-taylor-francis-ltd-9781138875067-a-series-of-essays-max-schoen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138875067.jpg?v=1767770684</image:loc>
      <image:title>Effects of Music</image:title>
      <image:caption>Book cover of: Effects of Music. By: Max Schoen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-personal-involvement-in-narrative-discourse-taylor-francis-inc-9780805895278-a-special-issue-of-discourse-processes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805895278.jpg?v=1767770685</image:loc>
      <image:title>Effects of Personal Involvement in Narrative Discourse</image:title>
      <image:caption>Book cover of: Effects of Personal Involvement in Narrative Discourse</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-springer-9789400980624-a-guide-to-symptoms-and-signs-of-common-diseases-and-disorders-presented-in-systematic-form-a-d-g-gunn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789400980624.jpg?v=1767770686</image:loc>
      <image:title>Differential Diagnosis</image:title>
      <image:caption>Book cover of: Differential Diagnosis. By: A.D. G. Gunn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-in-conventional-radiology-thieme-publishing-group-9783136561034-f-a-burgener</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783136561034.jpg?v=1767770686</image:loc>
      <image:title>Differential Diagnosis in Conventional Radiology</image:title>
      <image:caption>Book cover of: Differential Diagnosis in Conventional Radiology. By: F. A. Burgener</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnosis-for-the-dermatologist-springer-verlag-berlin-and-heidelberg-gmbh-co-kg-9783642280054-scott-jackson-undifferentiated</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783642280054.jpg?v=1767770687</image:loc>
      <image:title>Differential Diagnosis for the Dermatologist</image:title>
      <image:caption>Book cover of: Differential Diagnosis for the Dermatologist. By: Scott Jackson - undifferentiated</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-aesthetics-taylor-francis-ltd-9781138741669-art-practices-philosophy-and-feminist-understandings-penny-florence</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138741669.jpg?v=1767770688</image:loc>
      <image:title>Differential Aesthetics</image:title>
      <image:caption>Book cover of: Differential Aesthetics. By: Penny Florence</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-algebras-in-topology-taylor-francis-inc-9781568810010</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781568810010.jpg?v=1767770686</image:loc>
      <image:title>Differential Algebras in Topology</image:title>
      <image:caption>Book cover of: Differential Algebras in Topology</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-taxation-on-multinational-corporations-the-university-of-chicago-press-9780226240954</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226240954.jpg?v=1767770685</image:loc>
      <image:title>Effects of Taxation on Multinational Corporations</image:title>
      <image:caption>Book cover of: Effects of Taxation on Multinational Corporations</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-and-integral-inequalities-springer-nature-switzerland-ag-9783030274061-dorin-andrica</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783030274061.jpg?v=1767770686</image:loc>
      <image:title>Differential and Integral Inequalities</image:title>
      <image:caption>Book cover of: Differential and Integral Inequalities. By: Dorin Andrica</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-knut-hamsun-on-a-fresno-boy-persea-books-inc-9780892552542-recollections-and-short-essays-gary-soto</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-algebras-in-topology-taylor-francis-ltd-9780367450038</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367450038.jpg?v=1767770688</image:loc>
      <image:title>Differential Algebras in Topology</image:title>
      <image:caption>Book cover of: Differential Algebras in Topology</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-intimate-partner-violence-on-children-taylor-francis-inc-9780789021601</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789021601.jpg?v=1767770685</image:loc>
      <image:title>Effects of Intimate Partner Violence on Children</image:title>
      <image:caption>Book cover of: Effects of Intimate Partner Violence on Children</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-intimate-partner-violence-on-children-taylor-francis-inc-9780789021618</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789021618.jpg?v=1767770685</image:loc>
      <image:title>Effects of Intimate Partner Violence on Children</image:title>
      <image:caption>Book cover of: Effects of Intimate Partner Violence on Children</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-mergers-taylor-francis-ltd-9780415313469-ruth-cohen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415313469.jpg?v=1767770685</image:loc>
      <image:title>Effects of Mergers</image:title>
      <image:caption>Book cover of: Effects of Mergers. By: Ruth Cohen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-mergers-taylor-francis-ltd-9780415758574-ruth-cohen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415758574.jpg?v=1767770684</image:loc>
      <image:title>Effects of Mergers</image:title>
      <image:caption>Book cover of: Effects of Mergers. By: Ruth Cohen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-aesthetics-taylor-francis-ltd-9781138741645-art-practices-philosophy-and-feminist-understandings-penny-florence</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138741645.jpg?v=1767770688</image:loc>
      <image:title>Differential Aesthetics</image:title>
      <image:caption>Book cover of: Differential Aesthetics. By: Penny Florence</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differential-diagnoses-in-surgical-pathology-cytopathology-wolters-kluwer-health-9781975113148-syed-ali-md</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781975113148.jpg?v=1767770690</image:loc>
      <image:title>Differential Diagnoses in Surgical Pathology: Cytopathology</image:title>
      <image:caption>Book cover of: Differential Diagnoses in Surgical Pathology: Cytopathology. By: Syed Ali MD</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-esoteric-development-anthroposophic-press-inc-9780880104203-ten-lectures-at-the-hague-march-20-29-1913</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780880104203.jpg?v=1767770687</image:loc>
      <image:title>Effects of Esoteric Development</image:title>
      <image:caption>Book cover of: Effects of Esoteric Development</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-estrogen-on-brain-function-johns-hopkins-university-press-9780801882821</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780801882821.jpg?v=1767770687</image:loc>
      <image:title>Effects of Estrogen on Brain Function</image:title>
      <image:caption>Book cover of: Effects of Estrogen on Brain Function</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differente-bildungsorte-in-systemischer-vernetzung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631350928-eine-antwort-auf-das-problem-der-funktionellen-differenzierung-in-der-kooperation-zwischen-jugendarbeit-und-schule-gerhard-baltes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631350928.jpg?v=1767770688</image:loc>
      <image:title>Differente Bildungsorte in systemischer Vernetzung</image:title>
      <image:caption>Book cover of: Differente Bildungsorte in systemischer Vernetzung. By: Gerhard Baltes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-immune-cells-and-inflammation-on-smooth-muscle-and-enteric-nerves-taylor-francis-inc-9780849301742</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780849301742.jpg?v=1767770685</image:loc>
      <image:title>Effects of Immune Cells and Inflammation On Smooth Muscle and Enteric Nerves</image:title>
      <image:caption>Book cover of: Effects of Immune Cells and Inflammation On Smooth Muscle and Enteric Nerves</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-not-less-future-horizons-incorporated-9781949177473-inspiring-stories-of-achievement-and-successful-employment-from-adults-with-autism-asperger-s-and-adhd-revised-updated-temple-grandin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781949177473.jpg?v=1767770687</image:loc>
      <image:title>Different...not Less</image:title>
      <image:caption>Book cover of: Different...not Less. By: Temple Grandin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-energy-price-changes-on-commodity-prices-interprovincial-trade-and-employment-university-of-toronto-press-9780802033376-james-r-melvin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780802033376.jpg?v=1767770687</image:loc>
      <image:title>Effects of Energy Price Changes on Commodity Prices, Interprovincial Trade, and Employment</image:title>
      <image:caption>Book cover of: Effects of Energy Price Changes on Commodity Prices, Interprovincial Trade, and Employment. By: James R. Melvin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-light-on-materials-in-collections-data-on-photoflash-and-related-sources-getty-trust-publications-9780892366453</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780892366453.jpg?v=1767770687</image:loc>
      <image:title>Effects of Light on Materials in Collections – Data on Photoflash and Related Sources</image:title>
      <image:caption>Book cover of: Effects of Light on Materials in Collections – Data on Photoflash and Related Sources</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-persistent-and-bioactive-organic-pollutants-on-human-health-john-wiley-sons-inc-9781118159262-david-o-carpenter</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781118159262.jpg?v=1767770687</image:loc>
      <image:title>Effects of Persistent and Bioactive Organic Pollutants on Human Health</image:title>
      <image:caption>Book cover of: Effects of Persistent and Bioactive Organic Pollutants on Human Health. By: David O. Carpenter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-early-adversity-on-neurobehavioral-development-taylor-francis-inc-9780805834062-charles-a-nelson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805834062.jpg?v=1767770689</image:loc>
      <image:title>Effects of Early Adversity on Neurobehavioral Development</image:title>
      <image:caption>Book cover of: Effects of Early Adversity on Neurobehavioral Development. By: Charles A. Nelson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-duration-and-sonority-on-countour-tone-distribution-taylor-francis-ltd-9781138968462-a-typological-survey-and-formal-analysis-jie-zhang</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138968462.jpg?v=1767770687</image:loc>
      <image:title>Effects of Duration and Sonority on Countour Tone Distribution</image:title>
      <image:caption>Book cover of: Effects of Duration and Sonority on Countour Tone Distribution. By: Jie Zhang</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differentiability-and-fractality-in-dynamics-of-physical-systems-world-scientific-publishing-co-pte-ltd-9789814678384-ioan-merches</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814678384.jpg?v=1767770691</image:loc>
      <image:title>Differentiability And Fractality In Dynamics Of Physical Systems</image:title>
      <image:caption>Book cover of: Differentiability And Fractality In Dynamics Of Physical Systems. By: Ioan Merches</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-early-adversity-on-neurobehavioral-development-taylor-francis-ltd-9781138003392-charles-a-nelson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138003392.jpg?v=1767770685</image:loc>
      <image:title>Effects of Early Adversity on Neurobehavioral Development</image:title>
      <image:caption>Book cover of: Effects of Early Adversity on Neurobehavioral Development. By: Charles A. Nelson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-duration-and-sonority-on-countour-tone-distribution-taylor-francis-ltd-9780415941563-a-typological-survey-and-formal-analysis-zhang-jie</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415941563.jpg?v=1767770687</image:loc>
      <image:title>Effects of Duration and Sonority on Countour Tone Distribution</image:title>
      <image:caption>Book cover of: Effects of Duration and Sonority on Countour Tone Distribution. By: Zhang, Jie</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-transition-path-taylor-francis-ltd-9781138314306-ownership-performance-and-influence-of-chinese-rural-industrial-enterprises-chenggang-xu</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138314306.jpg?v=1767770687</image:loc>
      <image:title>Different Transition Path</image:title>
      <image:caption>Book cover of: Different Transition Path. By: Chenggang Xu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-wisdom-taylor-francis-ltd-9781855756144-reflections-on-supervision-practice-guide-to-supervision-penny-henderson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781855756144.jpg?v=1767770689</image:loc>
      <image:title>Different Wisdom</image:title>
      <image:caption>Book cover of: Different Wisdom. By: Penny Henderson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-and-interventions-for-childhood-trauma-from-infancy-through-adolescence-taylor-francis-inc-9780789024282-pain-unspeakable-sandra-b-hutchison</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789024282.jpg?v=1767770685</image:loc>
      <image:title>Effects of and Interventions for Childhood Trauma from Infancy Through Adolescence</image:title>
      <image:caption>Book cover of: Effects of and Interventions for Childhood Trauma from Infancy Through Adolescence. By: Sandra B. Hutchison</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-thermodynamics-and-its-true-heroes-pan-stanford-publishing-pte-ltd-9789814774918-evgeni-b-starikov</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814774918.jpg?v=1767770689</image:loc>
      <image:title>Different Thermodynamics and its True Heroes</image:title>
      <image:caption>Book cover of: Different Thermodynamics and its True Heroes. By: Evgeni B. Starikov</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-way-of-being-langham-publishing-9781783685806-towards-a-reformed-theology-of-ethnopolitical-cohesion-for-the-kenyan-context</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781783685806.jpg?v=1767770691</image:loc>
      <image:title>Different Way of Being</image:title>
      <image:caption>Book cover of: Different Way of Being</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-and-interventions-for-childhood-trauma-from-infancy-through-adolescence-taylor-francis-inc-9780789008565-pain-unspeakable-sandra-b-hutchison</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789008565.jpg?v=1767770686</image:loc>
      <image:title>Effects of and Interventions for Childhood Trauma from Infancy Through Adolescence</image:title>
      <image:caption>Book cover of: Effects of and Interventions for Childhood Trauma from Infancy Through Adolescence. By: Sandra B. Hutchison</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-equipment-age-on-mission-critical-failure-rates-rand-9780833034939-a-study-of-m1-tanks-2004-eric-peltz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780833034939.jpg?v=1767770690</image:loc>
      <image:title>Effects of Equipment Age on Mission Critical Failure Rates</image:title>
      <image:caption>Book cover of: Effects of Equipment Age on Mission Critical Failure Rates. By: Eric Peltz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-strokes-university-of-nebraska-press-9781496214652-serena-venus-and-the-unfinished-black-tennis-revolution-cecil-harris</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781496214652.jpg?v=1767770689</image:loc>
      <image:title>Different Strokes</image:title>
      <image:caption>Book cover of: Different Strokes. By: Cecil Harris</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-pond-capstone-global-library-ltd-9781474791144-bao-phi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781474791144.jpg?v=1767770688</image:loc>
      <image:title>Different Pond</image:title>
      <image:caption>Book cover of: Different Pond. By: Bao Phi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effectiveness-of-mathematics-teaching-in-primary-schools-taylor-francis-ltd-9780367178635-lessons-from-england-and-china-zhenzhen-miao</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367178635.jpg?v=1767770688</image:loc>
      <image:title>Effectiveness of Mathematics Teaching in Primary Schools</image:title>
      <image:caption>Book cover of: Effectiveness of Mathematics Teaching in Primary Schools. By: Zhenzhen Miao</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effectiveness-of-european-union-environmental-policy-palgrave-macmillan-9780333730669-wyn-grant</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780333730669.jpg?v=1767770688</image:loc>
      <image:title>Effectiveness of European Union Environmental Policy</image:title>
      <image:caption>Book cover of: Effectiveness of European Union Environmental Policy. By: Wyn Grant</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effectiveness-of-the-un-human-rights-system-taylor-francis-ltd-9780367224240-reform-and-the-judicialisation-of-human-rights-subedi-obe-qc-hon-surya-p</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367224240.jpg?v=1767770692</image:loc>
      <image:title>Effectiveness of the UN Human Rights System</image:title>
      <image:caption>Book cover of: Effectiveness of the UN Human Rights System. By: Subedi, OBE, QC (Hon), Surya P.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effects-of-climate-change-on-birds-oxford-university-press-9780198824268-peter-o-dunn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780198824268.jpg?v=1767770687</image:loc>
      <image:title>Effects of Climate Change on Birds</image:title>
      <image:caption>Book cover of: Effects of Climate Change on Birds. By: Peter O. Dunn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-road-taken-taylor-francis-ltd-9780367154684-profiles-in-critical-communication</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367154684.jpg?v=1767770686</image:loc>
      <image:title>Different Road Taken</image:title>
      <image:caption>Book cover of: Different Road Taken</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-road-taken-taylor-francis-ltd-9780367004811-profiles-in-critical-communication</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367004811.jpg?v=1767770689</image:loc>
      <image:title>Different Road Taken</image:title>
      <image:caption>Book cover of: Different Road Taken</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-paths-to-curbing-corruption-emerald-publishing-limited-9781781907306-lessons-from-denmark-finland-hong-kong-new-zealand-and-singapore-jon-s-t-quah</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781781907306.jpg?v=1767770689</image:loc>
      <image:title>Different Paths to Curbing Corruption</image:title>
      <image:caption>Book cover of: Different Paths to Curbing Corruption. By: Jon S. T. Quah</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-perspectives-on-flood-insurance-reform-nova-science-publishers-inc-9781536169652-mason-connah</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781536169652.jpg?v=1767770688</image:loc>
      <image:title>Different Perspectives on Flood Insurance Reform</image:title>
      <image:caption>Book cover of: Different Perspectives on Flood Insurance Reform. By: Mason Connah</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-strokes-authorhouse-9781467043120-the-gods-are-not-to-blame</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781467043120.jpg?v=1767770690</image:loc>
      <image:title>Different Strokes</image:title>
      <image:caption>Book cover of: Different Strokes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effectiveness-of-the-european-court-of-justice-manchester-university-press-9780719083068-why-reluctant-states-comply-diana-panke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780719083068.jpg?v=1767770690</image:loc>
      <image:title>Effectiveness of the European Court of Justice</image:title>
      <image:caption>Book cover of: Effectiveness of the European Court of Justice. By: Diana Panke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-places-different-voices-taylor-francis-ltd-9781138475588-gender-and-development-in-africa-asia-and-latin-america-vivian-kinnaird</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138475588.jpg?v=1767770689</image:loc>
      <image:title>Different Places, Different Voices</image:title>
      <image:caption>Book cover of: Different Places, Different Voices. By: Vivian Kinnaird</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-transition-path-taylor-francis-ltd-9781138314399-ownership-performance-and-influence-of-chinese-rural-industrial-enterprises-chenggang-xu</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138314399.jpg?v=1767770688</image:loc>
      <image:title>Different Transition Path</image:title>
      <image:caption>Book cover of: Different Transition Path. By: Chenggang Xu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-writing-in-the-public-sector-taylor-francis-ltd-9780765641496-john-w-swain</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780765641496.jpg?v=1767770690</image:loc>
      <image:title>Effective Writing in the Public Sector</image:title>
      <image:caption>Book cover of: Effective Writing in the Public Sector. By: John W. Swain</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-perspectives-on-the-syrian-reality-ibidem-verlag-jessica-haunschild-u-christian-schon-9783838211619-research-in-the-diverse-fields-of-syrian-culture-dima-shehadeh</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783838211619.jpg?v=1767770692</image:loc>
      <image:title>Different Perspectives on the Syrian Reality</image:title>
      <image:caption>Book cover of: Different Perspectives on the Syrian Reality. By: Dima Shehadeh</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effectors-in-plant-microbe-interactions-john-wiley-and-sons-ltd-9780470958223-francis-martin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780470958223.jpg?v=1767770689</image:loc>
      <image:title>Effectors in Plant-Microbe Interactions</image:title>
      <image:caption>Book cover of: Effectors in Plant-Microbe Interactions. By: Francis Martin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-writing-teacher-s-manual-cambridge-university-press-9780521316095-writing-skills-for-intermediate-students-of-american-english</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521316095.jpg?v=1767770689</image:loc>
      <image:title>Effective Writing Teacher&apos;s manual</image:title>
      <image:caption>Book cover of: Effective Writing Teacher&apos;s manual</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-writing-student-s-book-cambridge-university-press-9780521316088-writing-skills-for-intermediate-students-of-american-english</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521316088.jpg?v=1767770688</image:loc>
      <image:title>Effective Writing Student&apos;s book</image:title>
      <image:caption>Book cover of: Effective Writing Student&apos;s book</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-paths-towards-sustainable-biofuels-intersentia-ltd-9781780684130-a-comparative-study-of-the-international-eu-and-chinese-regulation-of-the-sustainability-of-biofuels-taotao-yue</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781780684130.jpg?v=1767770691</image:loc>
      <image:title>Different Paths Towards Sustainable Biofuels?</image:title>
      <image:caption>Book cover of: Different Paths Towards Sustainable Biofuels?. By: Taotao Yue</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effectiveness-of-remotely-piloted-aircraft-in-a-permissive-hunter-killer-scenario-rand-9780833083975-lance-menthe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780833083975.jpg?v=1767770689</image:loc>
      <image:title>Effectiveness of Remotely Piloted Aircraft in a Permissive Hunter-Killer Scenario</image:title>
      <image:caption>Book cover of: Effectiveness of Remotely Piloted Aircraft in a Permissive Hunter-Killer Scenario. By: Lance Menthe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effectively-managing-natural-gas-costs-taylor-francis-inc-9780849339097-john-m-studebaker</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780849339097.jpg?v=1767770689</image:loc>
      <image:title>Effectively Managing Natural Gas Costs</image:title>
      <image:caption>Book cover of: Effectively Managing Natural Gas Costs. By: John M. Studebaker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-order-of-difficulty-the-university-of-chicago-press-9780226677156-literature-after-wittgenstein-karen-zumhagen-yekpl</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226677156.jpg?v=1767770691</image:loc>
      <image:title>Different Order of Difficulty</image:title>
      <image:caption>Book cover of: Different Order of Difficulty. By: Karen Zumhagen-Yekplé</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-written-advocacy-wildy-simmonds-and-hill-publishing-9780854900954-a-guide-for-practitioners</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780854900954.jpg?v=1767770688</image:loc>
      <image:title>Effective Written Advocacy</image:title>
      <image:caption>Book cover of: Effective Written Advocacy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-writing-strategies-for-engineers-and-scientists-taylor-francis-inc-9780873710992</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780873710992.jpg?v=1767770688</image:loc>
      <image:title>Effective Writing Strategies for Engineers and Scientists</image:title>
      <image:caption>Book cover of: Effective Writing Strategies for Engineers and Scientists</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-workforce-development-taylor-francis-ltd-9780367332501-a-concise-guide-for-hr-and-line-managers-antonios-panagiotakopoulos</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367332501.jpg?v=1767770691</image:loc>
      <image:title>Effective Workforce Development</image:title>
      <image:caption>Book cover of: Effective Workforce Development. By: Antonios Panagiotakopoulos</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-writing-taylor-francis-ltd-9781138134966-improving-scientific-technical-and-business-communication-john-kirkman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138134966.jpg?v=1767770690</image:loc>
      <image:title>Effective Writing</image:title>
      <image:caption>Book cover of: Effective Writing. By: John Kirkman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-order-of-difficulty-literature-after-wittgenstein-the-university-of-chicago-press-9780226677019-karen-zumhagen-yekpl</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226677019.jpg?v=1767770689</image:loc>
      <image:title>Different Order of Difficulty – Literature after Wittgenstein</image:title>
      <image:caption>Book cover of: Different Order of Difficulty – Literature after Wittgenstein. By: Karen Zumhagen-Yekplé</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-writing-taylor-francis-ltd-9780419146605-improving-scientific-technical-and-business-communication</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780419146605.jpg?v=1767770690</image:loc>
      <image:title>Effective Writing</image:title>
      <image:caption>Book cover of: Effective Writing</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-minds-jessica-kingsley-publishers-9781853029646-gifted-children-with-ad-hd-asperger-syndrome-and-other-learning-deficits-deirdre-v-lovecky</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781853029646.jpg?v=1767770690</image:loc>
      <image:title>Different Minds</image:title>
      <image:caption>Book cover of: Different Minds. By: Deirdre V. Lovecky</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-kind-of-war-berghahn-books-9781845452223-the-un-sanctions-regime-in-iraq-unknown</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781845452223.jpg?v=1767770690</image:loc>
      <image:title>Different Kind of War</image:title>
      <image:caption>Book cover of: Different Kind of War. By: UNKNOWN</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-writing-in-the-public-sector-taylor-francis-ltd-9780765641502-john-w-swain</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780765641502.jpg?v=1767770689</image:loc>
      <image:title>Effective Writing in the Public Sector</image:title>
      <image:caption>Book cover of: Effective Writing in the Public Sector. By: John W. Swain</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-minds-jessica-kingsley-publishers-9781849059244-gifted-children-with-adhd-asd-and-other-dual-exceptionalities-deirdre-v-lovecky</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781849059244.jpg?v=1767770692</image:loc>
      <image:title>Different Minds</image:title>
      <image:caption>Book cover of: Different Minds. By: Deirdre V. Lovecky</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-use-of-information-technology-rand-9780833034267-lessons-about-state-governance-structures-and-processes-robert-anderson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780833034267.jpg?v=1767770689</image:loc>
      <image:title>Effective Use of Information Technology</image:title>
      <image:caption>Book cover of: Effective Use of Information Technology. By: Robert Anderson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-kind-of-love-story-baker-publishing-group-9780801094835-how-god-s-love-for-you-helps-you-love-yourself-landra-young-hughes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780801094835.jpg?v=1767770691</image:loc>
      <image:title>Different Kind of Love Story</image:title>
      <image:caption>Book cover of: Different Kind of Love Story. By: Landra Young Hughes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-way-to-stop-drinking-penguin-books-ltd-9780140266641-beauchamp-colclough</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780140266641.jpg?v=1767770695</image:loc>
      <image:title>Effective Way to Stop Drinking</image:title>
      <image:caption>Book cover of: Effective Way to Stop Drinking. By: Beauchamp Colclough</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-minds-goose-lane-editions-9780864924438-living-with-alzheimer-disease-lorna-drew</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780864924438.jpg?v=1767770690</image:loc>
      <image:title>Different Minds</image:title>
      <image:caption>Book cover of: Different Minds. By: Lorna Drew</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-land-old-barn-books-9781910646496</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781910646496.jpg?v=1767770691</image:loc>
      <image:title>Different Land</image:title>
      <image:caption>Book cover of: Different Land</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-use-of-teams-for-it-audits-taylor-francis-ltd-9780849398285-martin-krist</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780849398285.jpg?v=1767770690</image:loc>
      <image:title>Effective Use of Teams for IT Audits</image:title>
      <image:caption>Book cover of: Effective Use of Teams for IT Audits. By: Martin Krist</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-treatments-in-psychiatry-cambridge-university-press-9780521124652-peter-j-tyrer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521124652.jpg?v=1767770689</image:loc>
      <image:title>Effective Treatments in Psychiatry</image:title>
      <image:caption>Book cover of: Effective Treatments in Psychiatry. By: Peter J. Tyrer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-time-management-revised-edition-pan-macmillan-9780330504249-how-to-save-time-and-spend-it-wisely-adair-john</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780330504249.jpg?v=1767770691</image:loc>
      <image:title>Effective Time Management (Revised edition)</image:title>
      <image:caption>Book cover of: Effective Time Management (Revised edition). By: Adair, John</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-techniques-to-motivate-mathematics-instruction-taylor-francis-ltd-9781138640955-alfred-s-posamentier</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138640955.jpg?v=1767770690</image:loc>
      <image:title>Effective Techniques to Motivate Mathematics Instruction</image:title>
      <image:caption>Book cover of: Effective Techniques to Motivate Mathematics Instruction. By: Alfred S. Posamentier</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-writing-skills-for-social-work-students-sage-publications-ltd-9780857254177</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780857254177.jpg?v=1767770692</image:loc>
      <image:title>Effective Writing Skills for Social Work Students</image:title>
      <image:caption>Book cover of: Effective Writing Skills for Social Work Students</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-techniques-to-motivate-mathematics-instruction-taylor-francis-ltd-9781138640948-alfred-posamentier</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138640948.jpg?v=1767770689</image:loc>
      <image:title>Effective Techniques to Motivate Mathematics Instruction</image:title>
      <image:caption>Book cover of: Effective Techniques to Motivate Mathematics Instruction. By: Alfred Posamentier</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-tv-production-taylor-francis-ltd-9781138140325-gerald-millerson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138140325.jpg?v=1767770693</image:loc>
      <image:title>Effective TV Production</image:title>
      <image:caption>Book cover of: Effective TV Production. By: Gerald Millerson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teaching-of-history-the-taylor-francis-ltd-9781138165892-ron-brooks</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138165892.jpg?v=1767770690</image:loc>
      <image:title>Effective Teaching of History, The</image:title>
      <image:caption>Book cover of: Effective Teaching of History, The. By: Ron Brooks</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-kind-of-evil-simon-schuster-ltd-9781471148279-andrew-wilson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781471148279.jpg?v=1767770691</image:loc>
      <image:title>Different Kind of Evil</image:title>
      <image:caption>Book cover of: Different Kind of Evil. By: ANDREW WILSON</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-kind-of-victory-naval-institute-press-9781591142614-a-biography-of-admiral-thomas-c-hart-james-leutze</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781591142614.jpg?v=1767770691</image:loc>
      <image:title>Different Kind of Victory</image:title>
      <image:caption>Book cover of: Different Kind of Victory. By: James Leutze</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-weight-loss-oxford-university-press-inc-9780190232009-an-acceptance-based-behavioral-approach-clinician-guide-evan-m-forman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780190232009.jpg?v=1767770692</image:loc>
      <image:title>Effective Weight Loss</image:title>
      <image:caption>Book cover of: Effective Weight Loss. By: Evan M. Forman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-tv-production-taylor-francis-ltd-9780240513249</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780240513249.jpg?v=1767770692</image:loc>
      <image:title>Effective TV Production</image:title>
      <image:caption>Book cover of: Effective TV Production</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teaching-taylor-francis-ltd-9780415109161</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415109161.jpg?v=1767770690</image:loc>
      <image:title>Effective Teaching</image:title>
      <image:caption>Book cover of: Effective Teaching</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-genes-troubador-publishing-9781788036054-claire-baldry</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781788036054.jpg?v=1767770690</image:loc>
      <image:title>Different Genes</image:title>
      <image:caption>Book cover of: Different Genes. By: Claire Baldry</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-kind-of-boy-jessica-kingsley-publishers-9781843107156-a-father-s-memoir-about-raising-a-gifted-child-with-autism-daniel-mont</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781843107156.jpg?v=1767770691</image:loc>
      <image:title>Different Kind of Boy</image:title>
      <image:caption>Book cover of: Different Kind of Boy. By: Daniel Mont</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-game-burford-books-u-s-9781580801218-golf-after-50-hershel-sarbin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781580801218.jpg?v=1767770692</image:loc>
      <image:title>Different Game</image:title>
      <image:caption>Book cover of: Different Game. By: Hershel Sarbin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teaching-of-religious-education-taylor-francis-ltd-9781138169746-brenda-watson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138169746.jpg?v=1767770691</image:loc>
      <image:title>Effective Teaching of Religious Education</image:title>
      <image:caption>Book cover of: Effective Teaching of Religious Education. By: Brenda Watson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teaching-in-higher-education-taylor-francis-ltd-9780415036757-madelein-atkins</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415036757.jpg?v=1767770691</image:loc>
      <image:title>Effective Teaching in Higher Education</image:title>
      <image:caption>Book cover of: Effective Teaching in Higher Education. By: Madelein Atkins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teaching-strategies-that-accommodate-diverse-learners-pearson-education-us-9780137084708-michael-d-coyne</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780137084708.jpg?v=1767770691</image:loc>
      <image:title>Effective Teaching Strategies that Accommodate Diverse Learners</image:title>
      <image:caption>Book cover of: Effective Teaching Strategies that Accommodate Diverse Learners. By: Michael D. Coyne</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-germans-many-germanies-berghahn-books-9781789200782-new-transatlantic-perspectives-konrad-h-jarausch</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781789200782.jpg?v=1767770691</image:loc>
      <image:title>Different Germans, Many Germanies</image:title>
      <image:caption>Book cover of: Different Germans, Many Germanies. By: Konrad H. Jarausch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teaching-in-gifted-education-taylor-francis-ltd-9780415493451-using-a-whole-school-approach-wendy-robinson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415493451.jpg?v=1767770692</image:loc>
      <image:title>Effective Teaching in Gifted Education</image:title>
      <image:caption>Book cover of: Effective Teaching in Gifted Education. By: Wendy Robinson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-boy-old-barn-books-9781910646465</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781910646465.jpg?v=1767770695</image:loc>
      <image:title>Different Boy</image:title>
      <image:caption>Book cover of: Different Boy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-dog-old-barn-books-9781910646427</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781910646427.jpg?v=1767770694</image:loc>
      <image:title>Different Dog</image:title>
      <image:caption>Book cover of: Different Dog</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teaching-of-physical-education-taylor-francis-ltd-9781138148222-mick-mawer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138148222.jpg?v=1767770691</image:loc>
      <image:title>Effective Teaching of Physical Education</image:title>
      <image:caption>Book cover of: Effective Teaching of Physical Education. By: Mick Mawer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teaching-in-gifted-education-taylor-francis-ltd-9780415493468-using-a-whole-school-approach-wendy-robinson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415493468.jpg?v=1767770692</image:loc>
      <image:title>Effective Teaching in Gifted Education</image:title>
      <image:caption>Book cover of: Effective Teaching in Gifted Education. By: Wendy Robinson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-childhoods-taylor-francis-ltd-9781138654037-non-normative-development-and-transgressive-trajectories-lindsay-o-dell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138654037.jpg?v=1767770692</image:loc>
      <image:title>Different Childhoods</image:title>
      <image:caption>Book cover of: Different Childhoods. By: Lindsay O&apos;Dell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teaching-in-higher-education-taylor-francis-ltd-9781138133242-madeleine-atkins</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138133242.jpg?v=1767770692</image:loc>
      <image:title>Effective Teaching in Higher Education</image:title>
      <image:caption>Book cover of: Effective Teaching in Higher Education. By: Madeleine Atkins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-minds-morgan-james-publishing-llc-9781630474492-joyce-e-rayess</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781630474492.jpg?v=1767770691</image:loc>
      <image:title>Different Minds</image:title>
      <image:caption>Book cover of: Different Minds. By: Joyce E. Rayess</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teaching-and-successful-learning-cambridge-university-press-9781107112612-bridging-the-gap-between-research-and-practice-inez-de-florio</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781107112612.jpg?v=1767770695</image:loc>
      <image:title>Effective Teaching and Successful Learning</image:title>
      <image:caption>Book cover of: Effective Teaching and Successful Learning. By: Inez De Florio</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-treatment-of-logistics-resource-issues-in-the-air-force-planning-programming-and-budgeting-system-ppbs-process-rand-9780833032843-frank-camm</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780833032843.jpg?v=1767770691</image:loc>
      <image:title>Effective Treatment of Logistics Resource Issues in the Air Force Planning, Programming and Budgeting System (PPBS) Process</image:title>
      <image:caption>Book cover of: Effective Treatment of Logistics Resource Issues in the Air Force Planning, Programming and Budgeting System (PPBS) Process. By: Frank Camm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-kind-of-daughter-pan-macmillan-9781509800810-the-girl-who-hid-from-the-taliban-in-plain-sight-maria-toorpakai</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781509800810.jpg?v=1767770691</image:loc>
      <image:title>Different Kind of Daughter</image:title>
      <image:caption>Book cover of: Different Kind of Daughter. By: Maria Toorpakai</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-faces-of-being-overweight-nova-science-publishers-inc-9781634830997-risk-factors-for-the-evolution-towards-obesity-emilia-manzato</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781634830997.jpg?v=1767770691</image:loc>
      <image:title>Different Faces of Being Overweight</image:title>
      <image:caption>Book cover of: Different Faces of Being Overweight. By: Emilia Manzato</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-childhoods-taylor-francis-ltd-9781138654044-non-normative-development-and-transgressive-trajectories-lindsay-o-dell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138654044.jpg?v=1767770693</image:loc>
      <image:title>Different Childhoods</image:title>
      <image:caption>Book cover of: Different Childhoods. By: Lindsay O&apos;Dell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teaching-and-successful-learning-cambridge-university-press-9781107532908-bridging-the-gap-between-research-and-practice-inez-de-florio</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781107532908.jpg?v=1767770693</image:loc>
      <image:title>Effective Teaching and Successful Learning</image:title>
      <image:caption>Book cover of: Effective Teaching and Successful Learning. By: Inez De Florio</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-beasts-goose-lane-editions-9781773101262-j-r-mcconvey</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781773101262.jpg?v=1767770694</image:loc>
      <image:title>Different Beasts</image:title>
      <image:caption>Book cover of: Different Beasts. By: J. R. McConvey</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-every-time-profile-books-ltd-9781846687600-the-authorised-biography-of-robert-wyatt-o-dair-marcus</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781846687600.jpg?v=1767770695</image:loc>
      <image:title>Different Every Time</image:title>
      <image:caption>Book cover of: Different Every Time. By: O?Dair Marcus</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teacher-s-guide-to-sensory-and-physical-impairments-taylor-francis-ltd-9780415565677-sensory-orthopaedic-motor-and-health-impairments-and-traumatic-brain-injury-farrell-michael</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415565677.jpg?v=1767770693</image:loc>
      <image:title>Effective Teacher&apos;s Guide to Sensory and Physical Impairments</image:title>
      <image:caption>Book cover of: Effective Teacher&apos;s Guide to Sensory and Physical Impairments. By: Farrell, Michael</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-diversity-and-distinctiveness-in-education-and-learning-sage-publications-inc-9781412957953-laurence-parker</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781412957953.jpg?v=1767770691</image:loc>
      <image:title>Difference, Diversity, and Distinctiveness in Education and Learning</image:title>
      <image:caption>Book cover of: Difference, Diversity, and Distinctiveness in Education and Learning. By: Laurence Parker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teacher-s-guide-to-sensory-and-physical-impairments-taylor-francis-ltd-9780415565653-sensory-orthopaedic-motor-and-health-impairments-and-traumatic-brain-injury-farrell-michael</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415565653.jpg?v=1767770693</image:loc>
      <image:title>Effective Teacher&apos;s Guide to Sensory and Physical Impairments</image:title>
      <image:caption>Book cover of: Effective Teacher&apos;s Guide to Sensory and Physical Impairments. By: Farrell, Michael</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-baby-different-story-bloomsbury-publishing-plc-9781538125328-pregnancy-and-parenting-after-loss-o-leary</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781538125328.jpg?v=1767770692</image:loc>
      <image:title>Different Baby, Different Story</image:title>
      <image:caption>Book cover of: Different Baby, Different Story. By: O&apos;LEARY</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-drummer-quercus-publishing-9781787478039-the-extraordinary-rediscovered-classic-william-melvin-kelley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781787478039.jpg?v=1767770693</image:loc>
      <image:title>Different Drummer</image:title>
      <image:caption>Book cover of: Different Drummer. By: William Melvin Kelley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-aspects-on-chemotherapy-of-trypanosomatids-nova-science-publishers-inc-9781536108507-leonor-leon</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781536108507.jpg?v=1767770694</image:loc>
      <image:title>Different Aspects on Chemotherapy of Trypanosomatids</image:title>
      <image:caption>Book cover of: Different Aspects on Chemotherapy of Trypanosomatids. By: Leonor Leon</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-without-domination-the-university-of-chicago-press-9780226681191-pursuing-justice-in-diverse-democracies-danielle-allen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226681191.jpg?v=1767770695</image:loc>
      <image:title>Difference Without Domination</image:title>
      <image:caption>Book cover of: Difference Without Domination. By: Danielle Allen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differences-between-scientology-and-other-philosophies-bridge-publications-inc-9781403113801</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781403113801.jpg?v=1767770693</image:loc>
      <image:title>Differences Between Scientology and Other Philosophies</image:title>
      <image:caption>Book cover of: Differences Between Scientology and Other Philosophies</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-john-murray-press-9781473617827-living-the-holy-life-simon-ponsonby</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781473617827.jpg?v=1767770692</image:loc>
      <image:title>Different</image:title>
      <image:caption>Book cover of: Different. By: Simon Ponsonby</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teacher-s-guide-to-autism-and-communication-difficulties-taylor-francis-ltd-9780415693837-practical-strategies-farrell-michael</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415693837.jpg?v=1767770692</image:loc>
      <image:title>Effective Teacher&apos;s Guide to Autism and Communication Difficulties</image:title>
      <image:caption>Book cover of: Effective Teacher&apos;s Guide to Autism and Communication Difficulties. By: Farrell, Michael</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-without-domination-the-university-of-chicago-press-9780226681221-pursuing-justice-in-diverse-democracies-danielle-allen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226681221.jpg?v=1767770694</image:loc>
      <image:title>Difference Without Domination</image:title>
      <image:caption>Book cover of: Difference Without Domination. By: Danielle Allen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-dialogue-and-development-taylor-francis-ltd-9781138805934-a-bakhtinian-world-lakshmi-bandlamudi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138805934.jpg?v=1767770693</image:loc>
      <image:title>Difference, Dialogue, and Development</image:title>
      <image:caption>Book cover of: Difference, Dialogue, and Development. By: Lakshmi Bandlamudi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teacher-s-guide-to-behavioural-and-emotional-disorders-taylor-francis-ltd-9780415565684-disruptive-behaviour-disorders-anxiety-disorders-depressive-disorders-and-attention-deficit-hyperactivity-disorder-farrell-michael</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415565684.jpg?v=1767770692</image:loc>
      <image:title>Effective Teacher&apos;s Guide to Behavioural and Emotional Disorders</image:title>
      <image:caption>Book cover of: Effective Teacher&apos;s Guide to Behavioural and Emotional Disorders. By: Farrell, Michael</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teaching-of-biology-taylor-francis-ltd-9781138836075-chris-r-brown</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138836075.jpg?v=1767770693</image:loc>
      <image:title>Effective Teaching of Biology</image:title>
      <image:caption>Book cover of: Effective Teaching of Biology. By: Chris R. Brown</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-dads-jessica-kingsley-publishers-9781843104544-fathers-stories-of-parenting-disabled-children</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781843104544.jpg?v=1767770694</image:loc>
      <image:title>Different Dads</image:title>
      <image:caption>Book cover of: Different Dads</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-equations-and-inequalities-taylor-francis-ltd-9780367398941-theory-methods-and-applications-ravi-p-agarwal</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367398941.jpg?v=1767770693</image:loc>
      <image:title>Difference Equations and Inequalities</image:title>
      <image:caption>Book cover of: Difference Equations and Inequalities. By: Ravi P. Agarwal</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-makers-taylor-francis-ltd-9781906093044-how-social-and-institutional-entrepreneurs-created-the-corporate-responsibility-movement-sandra-a-waddock</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781906093044.jpg?v=1767770694</image:loc>
      <image:title>Difference Makers</image:title>
      <image:caption>Book cover of: Difference Makers. By: Sandra A. Waddock</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-equations-and-discrete-dynamical-systems-proceedings-of-the-9th-international-conference-world-scientific-publishing-co-pte-ltd-9789812565204</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789812565204.jpg?v=1767770694</image:loc>
      <image:title>Difference Equations And Discrete Dynamical Systems - Proceedings Of The 9th International Conference</image:title>
      <image:caption>Book cover of: Difference Equations And Discrete Dynamical Systems - Proceedings Of The 9th International Conference</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teacher-s-guide-to-moderate-severe-and-profound-learning-difficulties-cognitive-impairments-taylor-francis-ltd-9780415693868-practical-strategies-farrell-michael</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415693868.jpg?v=1767770694</image:loc>
      <image:title>Effective Teacher&apos;s Guide to Moderate, Severe and Profound Learning Difficulties (Cognitive Impairments)</image:title>
      <image:caption>Book cover of: Effective Teacher&apos;s Guide to Moderate, Severe and Profound Learning Difficulties (Cognitive Impairments). By: Farrell, Michael</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-identity-makes-atf-press-9781925302837-indigenous-cultural-capital-in-australian-cultural-fields-lawrence-bamblett</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781925302837.jpg?v=1767770692</image:loc>
      <image:title>Difference Identity Makes</image:title>
      <image:caption>Book cover of: Difference Identity Makes. By: Lawrence Bamblett</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-that-gender-makes-to-international-peace-and-security-taylor-francis-ltd-9781138607613-sara-e-davies</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138607613.jpg?v=1767770694</image:loc>
      <image:title>Difference that Gender Makes to International Peace and Security</image:title>
      <image:caption>Book cover of: Difference that Gender Makes to International Peace and Security. By: Sara E. Davies</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-methods-for-singular-perturbation-problems-taylor-francis-ltd-9780367386825-grigory-i-shishkin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367386825.jpg?v=1767770693</image:loc>
      <image:title>Difference Methods for Singular Perturbation Problems</image:title>
      <image:caption>Book cover of: Difference Methods for Singular Perturbation Problems. By: Grigory I. Shishkin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-not-disorder-jessica-kingsley-publishers-9781785924743-understanding-autism-theory-in-practice-dr-catherine-harvey</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781785924743.jpg?v=1767770694</image:loc>
      <image:title>Difference Not Disorder</image:title>
      <image:caption>Book cover of: Difference Not Disorder. By: Dr Catherine Harvey</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/differences-the-bible-and-the-koran-turner-publishing-company-9781581823493-ben-j-smith</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781581823493.jpg?v=1767770695</image:loc>
      <image:title>Differences: The Bible and the Koran</image:title>
      <image:caption>Book cover of: Differences: The Bible and the Koran. By: Ben J. Smith</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teacher-s-guide-to-behavioural-and-emotional-disorders-taylor-francis-ltd-9780415565691-disruptive-behaviour-disorders-anxiety-disorders-depressive-disorders-and-attention-deficit-hyperactivity-disorder-farrell-michael</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415565691.jpg?v=1767770694</image:loc>
      <image:title>Effective Teacher&apos;s Guide to Behavioural and Emotional Disorders</image:title>
      <image:caption>Book cover of: Effective Teacher&apos;s Guide to Behavioural and Emotional Disorders. By: Farrell, Michael</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-equations-with-random-coefficients-ibidem-verlag-jessica-haunschild-u-christian-schon-9783838203898-tamara-g-stryzhak</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783838203898.jpg?v=1767770693</image:loc>
      <image:title>Difference equations with random coefficients</image:title>
      <image:caption>Book cover of: Difference equations with random coefficients. By: Tamara G. Stryzhak</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-equations-taylor-francis-ltd-9781138894235-theory-applications-and-advanced-topics-third-edition-ronald-e-mickens</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138894235.jpg?v=1767770694</image:loc>
      <image:title>Difference Equations</image:title>
      <image:caption>Book cover of: Difference Equations. By: Ronald E. Mickens</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-and-repetition-in-language-shift-to-a-creole-taylor-francis-ltd-9781138601352-the-expression-of-emotions-ma-a-ponsonnet</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138601352.jpg?v=1767770695</image:loc>
      <image:title>Difference and Repetition in Language Shift to a Creole</image:title>
      <image:caption>Book cover of: Difference and Repetition in Language Shift to a Creole. By: Maïa Ponsonnet</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/different-faces-of-attachment-cambridge-university-press-9781316617984-cultural-variations-on-a-universal-human-need</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781316617984.jpg?v=1767770696</image:loc>
      <image:title>Different Faces of Attachment</image:title>
      <image:caption>Book cover of: Different Faces of Attachment</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-surveillance-for-homeland-security-taylor-francis-ltd-9781138199705-balancing-technology-and-social-issues-francesco-flammini</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138199705.jpg?v=1767770694</image:loc>
      <image:title>Effective Surveillance for Homeland Security</image:title>
      <image:caption>Book cover of: Effective Surveillance for Homeland Security. By: Francesco Flammini</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-speech-language-pathology-taylor-francis-inc-9780805820959-a-cognitive-socialization-approach-john-r-muma</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805820959.jpg?v=1767770692</image:loc>
      <image:title>Effective Speech-language Pathology</image:title>
      <image:caption>Book cover of: Effective Speech-language Pathology. By: John R. Muma</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-equations-special-functions-and-orthogonal-polynomials-proceedings-of-the-international-conference-world-scientific-publishing-co-pte-ltd-9789812706430</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789812706430.jpg?v=1767770695</image:loc>
      <image:title>Difference Equations, Special Functions And Orthogonal Polynomials - Proceedings Of The International Conference</image:title>
      <image:caption>Book cover of: Difference Equations, Special Functions And Orthogonal Polynomials - Proceedings Of The International Conference</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-and-orientation-cornell-university-press-9781501739200-an-alexander-kluge-reader-alexander-kluge</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781501739200.jpg?v=1767770693</image:loc>
      <image:title>Difference and Orientation</image:title>
      <image:caption>Book cover of: Difference and Orientation. By: Alexander Kluge</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-subject-leadership-taylor-francis-ltd-9780415202954</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415202954.jpg?v=1767770694</image:loc>
      <image:title>Effective Subject Leadership</image:title>
      <image:caption>Book cover of: Effective Subject Leadership</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teacher-s-guide-to-autism-and-communication-difficulties-taylor-francis-ltd-9780415693820-practical-strategies-farrell-michael</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415693820.jpg?v=1767770694</image:loc>
      <image:title>Effective Teacher&apos;s Guide to Autism and Communication Difficulties</image:title>
      <image:caption>Book cover of: Effective Teacher&apos;s Guide to Autism and Communication Difficulties. By: Farrell, Michael</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-speaking-taylor-francis-ltd-9781138141858-communicating-in-speech-christopher-turk</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138141858.jpg?v=1767770693</image:loc>
      <image:title>Effective Speaking</image:title>
      <image:caption>Book cover of: Effective Speaking. By: Christopher Turk</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teacher-induction-and-mentoring-teachers-college-press-9780807749333-assessing-the-evidence-michael-strong</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780807749333.jpg?v=1767770696</image:loc>
      <image:title>Effective Teacher Induction and Mentoring</image:title>
      <image:caption>Book cover of: Effective Teacher Induction and Mentoring. By: Michael Strong</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-and-orientation-cornell-university-press-9781501739217-an-alexander-kluge-reader-alexander-kluge</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781501739217.jpg?v=1767770696</image:loc>
      <image:title>Difference and Orientation</image:title>
      <image:caption>Book cover of: Difference and Orientation. By: Alexander Kluge</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-in-philosophy-of-religion-taylor-francis-ltd-9781138742529-philip-goodchild</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138742529.jpg?v=1767770694</image:loc>
      <image:title>Difference in Philosophy of Religion</image:title>
      <image:caption>Book cover of: Difference in Philosophy of Religion. By: Philip Goodchild</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-supply-teaching-sage-publications-inc-9780761942283-behaviour-management-classroom-discipline-and-colleague-support-bill-rogers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761942283.jpg?v=1767770695</image:loc>
      <image:title>Effective Supply Teaching</image:title>
      <image:caption>Book cover of: Effective Supply Teaching. By: Bill Rogers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-staffing-for-vital-churches-the-essentia-l-guide-to-finding-and-keeping-the-right-people-baker-publishing-group-9780801014901-william-m-easum</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780801014901.jpg?v=1767770694</image:loc>
      <image:title>Effective Staffing for Vital Churches The Essentia l Guide to Finding and Keeping the Right People</image:title>
      <image:caption>Book cover of: Effective Staffing for Vital Churches The Essentia l Guide to Finding and Keeping the Right People. By: William M. Easum</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-equations-taylor-francis-inc-9781482230789-theory-applications-and-advanced-topics-third-edition-ronald-e-mickens</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781482230789.jpg?v=1767770695</image:loc>
      <image:title>Difference Equations</image:title>
      <image:caption>Book cover of: Difference Equations. By: Ronald E. Mickens</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-teacher-s-guide-to-moderate-severe-and-profound-learning-difficulties-cognitive-impairments-taylor-francis-ltd-9780415693875-practical-strategies-farrell-michael</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415693875.jpg?v=1767770694</image:loc>
      <image:title>Effective Teacher&apos;s Guide to Moderate, Severe and Profound Learning Difficulties (Cognitive Impairments)</image:title>
      <image:caption>Book cover of: Effective Teacher&apos;s Guide to Moderate, Severe and Profound Learning Difficulties (Cognitive Impairments). By: Farrell, Michael</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-electron-nanoscope-pan-stanford-publishing-pte-ltd-9789814774017-methods-and-applications-werner-lottermoser</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9789814774017.jpg?v=1767770693</image:loc>
      <image:title>Difference Electron Nanoscope</image:title>
      <image:caption>Book cover of: Difference Electron Nanoscope. By: Werner Lottermoser</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-staff-training-in-social-care-taylor-francis-ltd-9780415160315-from-theory-to-practice-jan-horwath</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415160315.jpg?v=1767770695</image:loc>
      <image:title>Effective Staff Training in Social Care</image:title>
      <image:caption>Book cover of: Effective Staff Training in Social Care. By: Jan Horwath</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-methods-for-singular-perturbation-problems-taylor-francis-inc-9781584884590-grigory-i-shishkin-g-i-shishkin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781584884590.jpg?v=1767770695</image:loc>
      <image:title>Difference Methods for Singular Perturbation Problems</image:title>
      <image:caption>Book cover of: Difference Methods for Singular Perturbation Problems. By: Grigory I. Shishkin, G. I. Shishkin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-and-sameness-as-modes-of-integration-berghahn-books-9781789207651-anthropological-perspectives-on-ethnicity-and-religion-g-nther-schlee</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781789207651.jpg?v=1767770694</image:loc>
      <image:title>Difference and Sameness as Modes of Integration</image:title>
      <image:caption>Book cover of: Difference and Sameness as Modes of Integration. By: Günther Schlee</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-staff-training-in-social-care-taylor-francis-ltd-9780415160308-from-theory-to-practice-jan-horwath</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415160308.jpg?v=1767770694</image:loc>
      <image:title>Effective Staff Training in Social Care</image:title>
      <image:caption>Book cover of: Effective Staff Training in Social Care. By: Jan Horwath</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-and-democracy-campus-verlag-9783593395029-exploring-potentials-in-europe-and-beyond-kolja-raube</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783593395029.jpg?v=1767770696</image:loc>
      <image:title>Difference and Democracy</image:title>
      <image:caption>Book cover of: Difference and Democracy. By: Kolja Raube</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietrich-bonhoeffer-a-spoke-in-the-wheel-christian-focus-publications-ltd-9781527101623-dayspring-macleod</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781527101623.jpg?v=1767770696</image:loc>
      <image:title>Dietrich Bonhoeffer: A Spoke in the Wheel</image:title>
      <image:caption>Book cover of: Dietrich Bonhoeffer: A Spoke in the Wheel. By: Dayspring MacLeod</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-supply-teaching-sage-publications-inc-9780761942276-behaviour-management-classroom-discipline-and-colleague-support-bill-rogers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761942276.jpg?v=1767770695</image:loc>
      <image:title>Effective Supply Teaching</image:title>
      <image:caption>Book cover of: Effective Supply Teaching. By: Bill Rogers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-speaking-taylor-francis-ltd-9780419130307-communicating-in-speech</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780419130307.jpg?v=1767770695</image:loc>
      <image:title>Effective Speaking</image:title>
      <image:caption>Book cover of: Effective Speaking</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-supervisory-relationships-john-wiley-and-sons-ltd-9781118973639-best-evidence-and-practice-helen-beinart</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781118973639.jpg?v=1767770695</image:loc>
      <image:title>Effective Supervisory Relationships</image:title>
      <image:caption>Book cover of: Effective Supervisory Relationships. By: Helen Beinart</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-engine-bloomsbury-publishing-plc-9781442214354-computing-knowledge-and-the-transformation-of-learning-eugene-f-provenzo</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781442214354.jpg?v=1767770697</image:loc>
      <image:title>Difference Engine</image:title>
      <image:caption>Book cover of: Difference Engine. By: Eugene F. Provenzo</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-schools-in-developing-countries-taylor-francis-ltd-9780415668354-henry-levin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415668354.jpg?v=1767770694</image:loc>
      <image:title>Effective Schools in Developing Countries</image:title>
      <image:caption>Book cover of: Effective Schools in Developing Countries. By: Henry Levin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-taylor-francis-ltd-9781855759732-an-avoided-topic-in-practice</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781855759732.jpg?v=1767770695</image:loc>
      <image:title>Difference</image:title>
      <image:caption>Book cover of: Difference</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-stress-and-equilibrium-equation-for-soil-mechanics-taylor-francis-ltd-9781138092310-longtan-shao</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138092310.jpg?v=1767770695</image:loc>
      <image:title>Effective Stress and Equilibrium Equation for Soil Mechanics</image:title>
      <image:caption>Book cover of: Effective Stress and Equilibrium Equation for Soil Mechanics. By: Longtan Shao</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-speech-language-pathology-taylor-francis-inc-9780805820942-a-cognitive-socialization-approach-john-r-muma</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805820942.jpg?v=1767770696</image:loc>
      <image:title>Effective Speech-language Pathology</image:title>
      <image:caption>Book cover of: Effective Speech-language Pathology. By: John R. Muma</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietrich-bonhoeffer-s-letters-and-papers-from-prison-princeton-university-press-9780691202488-a-biography-martin-e-marty</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780691202488.jpg?v=1767770697</image:loc>
      <image:title>Dietrich Bonhoeffer&apos;s Letters and Papers from Prison</image:title>
      <image:caption>Book cover of: Dietrich Bonhoeffer&apos;s Letters and Papers from Prison. By: Martin E. Marty</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-schools-in-developing-countries-taylor-francis-ltd-9780415753265-henry-levin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415753265.jpg?v=1767770696</image:loc>
      <image:title>Effective Schools in Developing Countries</image:title>
      <image:caption>Book cover of: Effective Schools in Developing Countries. By: Henry Levin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-social-work-with-children-and-families-sage-publications-ltd-9780857027306-a-skills-handbook-peter-unwin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780857027306.jpg?v=1767770695</image:loc>
      <image:title>Effective Social Work with Children and Families</image:title>
      <image:caption>Book cover of: Effective Social Work with Children and Families. By: Peter Unwin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-site-investigation-emerald-publishing-limited-9780727735058-c-r-i-clayton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780727735058.jpg?v=1767770696</image:loc>
      <image:title>Effective Site Investigation</image:title>
      <image:caption>Book cover of: Effective Site Investigation. By: C. R. I. Clayton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietrich-bonhoeffer-theology-and-political-resistance-bloomsbury-publishing-plc-9781498591065-lori-brandt-hale</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781498591065.jpg?v=1767770698</image:loc>
      <image:title>Dietrich Bonhoeffer, Theology, and Political Resistance</image:title>
      <image:caption>Book cover of: Dietrich Bonhoeffer, Theology, and Political Resistance. By: Lori Brandt Hale</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-subject-leadership-in-secondary-schools-taylor-francis-ltd-9781138179721-a-handbook-of-staff-development-activities-alma-harris</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138179721.jpg?v=1767770696</image:loc>
      <image:title>Effective Subject Leadership in Secondary Schools</image:title>
      <image:caption>Book cover of: Effective Subject Leadership in Secondary Schools. By: Alma Harris</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietrich-bonhoeffer-lesen-im-internationalen-kontext-peter-lang-ag-9783631558096-von-suedafrika-bis-suedostasien</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631558096.jpg?v=1767770694</image:loc>
      <image:title>Dietrich Bonhoeffer Lesen Im Internationalen Kontext</image:title>
      <image:caption>Book cover of: Dietrich Bonhoeffer Lesen Im Internationalen Kontext</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-senco-meeting-the-challenge-open-university-press-9780335262045-janice-wearmouth</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780335262045.jpg?v=1767770696</image:loc>
      <image:title>Effective SENCO: Meeting the Challenge</image:title>
      <image:caption>Book cover of: Effective SENCO: Meeting the Challenge. By: Janice Wearmouth</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-science-communication-second-edition-institute-of-physics-publishing-9780750325189-a-practical-guide-to-surviving-as-a-scientist-allen-illingworth</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750325189.jpg?v=1767770694</image:loc>
      <image:title>Effective Science Communication (Second Edition)</image:title>
      <image:caption>Book cover of: Effective Science Communication (Second Edition). By: Allen ILLINGWORTH</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-pupil-grouping-in-the-primary-school-taylor-francis-ltd-9781138149809-a-practical-guide</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138149809.jpg?v=1767770694</image:loc>
      <image:title>Effective Pupil Grouping in the Primary School</image:title>
      <image:caption>Book cover of: Effective Pupil Grouping in the Primary School</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-software-maintenance-and-evolution-taylor-francis-ltd-9780849335921-a-reuse-based-approach-stanislaw-jarzabek</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780849335921.jpg?v=1767770696</image:loc>
      <image:title>Effective Software Maintenance and Evolution</image:title>
      <image:caption>Book cover of: Effective Software Maintenance and Evolution. By: Stanislaw Jarzabek</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-psychotherapy-with-borderline-patients-american-psychiatric-association-publishing-9780880482721-case-studies-robert-j-waldinger</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780880482721.jpg?v=1767770697</image:loc>
      <image:title>Effective Psychotherapy with Borderline Patients</image:title>
      <image:caption>Book cover of: Effective Psychotherapy with Borderline Patients. By: Robert J. Waldinger</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-seo-and-content-marketing-john-wiley-sons-inc-9781119628859-the-ultimate-guide-for-maximizing-free-web-traffic-nicholas-papagiannis</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781119628859.jpg?v=1767770698</image:loc>
      <image:title>Effective SEO and Content Marketing</image:title>
      <image:caption>Book cover of: Effective SEO and Content Marketing. By: Nicholas Papagiannis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-software-project-management-john-wiley-sons-inc-9780764596360-robert-k-wysocki</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780764596360.jpg?v=1767770697</image:loc>
      <image:title>Effective Software Project Management</image:title>
      <image:caption>Book cover of: Effective Software Project Management. By: Robert K. Wysocki</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-hachette-books-ireland-9781473625884-justine-delaney-wilson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781473625884.jpg?v=1767770695</image:loc>
      <image:title>Difference</image:title>
      <image:caption>Book cover of: Difference. By: Justine Delaney Wilson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-school-governor-taylor-francis-ltd-9780415223508</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415223508.jpg?v=1767770696</image:loc>
      <image:title>Effective School Governor</image:title>
      <image:caption>Book cover of: Effective School Governor</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-short-term-counselling-within-the-primary-care-setting-taylor-francis-ltd-9780367106645-psychodynamic-and-cognitive-behavioural-therapy-approaches</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367106645.jpg?v=1767770695</image:loc>
      <image:title>Effective Short-Term Counselling within the Primary Care Setting</image:title>
      <image:caption>Book cover of: Effective Short-Term Counselling within the Primary Care Setting</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-schooling-for-the-community-taylor-francis-ltd-9780415104180-core-plus-education</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415104180.jpg?v=1767770696</image:loc>
      <image:title>Effective Schooling for the Community</image:title>
      <image:caption>Book cover of: Effective Schooling for the Community</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-school-governor-taylor-francis-ltd-9780415223515</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415223515.jpg?v=1767770698</image:loc>
      <image:title>Effective School Governor</image:title>
      <image:caption>Book cover of: Effective School Governor</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietrich-untertrifaller-quart-publishers-9783037610633-roman-hollenstein</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783037610633.jpg?v=1767770697</image:loc>
      <image:title>Dietrich / Untertrifaller</image:title>
      <image:caption>Book cover of: Dietrich / Untertrifaller. By: Roman Hollenstein</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diets-diseases-nova-science-publishers-inc-9781634845809-causes-prevention-wenbiao-wu</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781634845809.jpg?v=1767770695</image:loc>
      <image:title>Diets &amp; Diseases</image:title>
      <image:caption>Book cover of: Diets &amp; Diseases. By: Wenbiao Wu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diez-leyes-irrefutables-para-la-destruccion-y-la-restauracion-economica-thomas-nelson-publishers-9781602554160-una-historia-destinada-a-cambiar-para-siempre-tu-futuro-economico</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781602554160.jpg?v=1767770696</image:loc>
      <image:title>Diez leyes irrefutables para la destruccion y la restauracion economica</image:title>
      <image:caption>Book cover of: Diez leyes irrefutables para la destruccion y la restauracion economica</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-sales-enablement-kogan-page-ltd-9780749483647-achieve-sales-growth-through-collaborative-sales-and-marketing-pam-didner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780749483647.jpg?v=1767770697</image:loc>
      <image:title>Effective Sales Enablement</image:title>
      <image:caption>Book cover of: Effective Sales Enablement. By: Pam Didner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-supplements-fda-use-of-adverse-event-reports-nova-science-publishers-inc-9781628080230-william-m-forsberg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781628080230.jpg?v=1767770698</image:loc>
      <image:title>Dietary Supplements &amp; FDA Use of Adverse Event Reports</image:title>
      <image:caption>Book cover of: Dietary Supplements &amp; FDA Use of Adverse Event Reports. By: William M. Forsberg</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-questioning-strategies-in-the-classroom-teachers-college-press-9780807753293-a-step-by-step-approach-to-engaged-thinking-and-learning-k-8-esther-fusco</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780807753293.jpg?v=1767770695</image:loc>
      <image:title>Effective Questioning Strategies in the Classroom</image:title>
      <image:caption>Book cover of: Effective Questioning Strategies in the Classroom. By: Esther Fusco</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-science-communication-institute-of-physics-publishing-9780750311717-a-practical-guide-to-surviving-as-a-scientist-sam-illingworth</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750311717.jpg?v=1767770695</image:loc>
      <image:title>Effective Science Communication</image:title>
      <image:caption>Book cover of: Effective Science Communication. By: Sam Illingworth</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/difference-taylor-francis-ltd-9780367324094-an-avoided-topic-in-practice-bernardine-bishop</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367324094.jpg?v=1767770697</image:loc>
      <image:title>Difference</image:title>
      <image:caption>Book cover of: Difference. By: Bernardine Bishop</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-schools-for-disaffected-students-taylor-francis-ltd-9780415064835-integration-and-segregation</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415064835.jpg?v=1767770696</image:loc>
      <image:title>Effective Schools for Disaffected Students</image:title>
      <image:caption>Book cover of: Effective Schools for Disaffected Students</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dieter-henrich-and-contemporary-philosophy-taylor-francis-ltd-9781138258013-the-return-to-subjectivity-dieter-freundlieb</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138258013.jpg?v=1767770698</image:loc>
      <image:title>Dieter Henrich and Contemporary Philosophy</image:title>
      <image:caption>Book cover of: Dieter Henrich and Contemporary Philosophy. By: Dieter Freundlieb</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietetic-restrictions-recommendations-in-homoeopathy-b-jain-publishers-pvt-ltd-9788131907238</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9788131907238.jpg?v=1767770697</image:loc>
      <image:title>Dietetic Restrictions &amp; Recommendations in Homoeopathy</image:title>
      <image:caption>Book cover of: Dietetic Restrictions &amp; Recommendations in Homoeopathy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dieter-jungling-und-andreas-hagmann-quart-publishers-9783907631317-de-aedibus-5</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783907631317.jpg?v=1767770699</image:loc>
      <image:title>Dieter Jungling Und Andreas Hagmann</image:title>
      <image:caption>Book cover of: Dieter Jungling Und Andreas Hagmann</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-processes-for-quality-assurance-taylor-francis-ltd-9780367172961-boyd-l-summers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367172961.jpg?v=1767770697</image:loc>
      <image:title>Effective Processes for Quality Assurance</image:title>
      <image:caption>Book cover of: Effective Processes for Quality Assurance. By: Boyd L. Summers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-supplements-and-multiple-sclerosis-demos-medical-publishing-9781888799903-a-health-professional-s-guide-allen-c-m-d-bowling</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781888799903.jpg?v=1767770696</image:loc>
      <image:title>Dietary Supplements and Multiple Sclerosis</image:title>
      <image:caption>Book cover of: Dietary Supplements and Multiple Sclerosis. By: Allen C., M.D. Bowling</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-primary-school-classroom-taylor-francis-ltd-9781138178571-the-essential-guide-for-new-teachers-joan-dean</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138178571.jpg?v=1767770696</image:loc>
      <image:title>Effective Primary School Classroom</image:title>
      <image:caption>Book cover of: Effective Primary School Classroom. By: Joan Dean</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-primary-teaching-taylor-francis-ltd-9781138165656-research-based-classroom-strategies-paul-croll</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138165656.jpg?v=1767770696</image:loc>
      <image:title>Effective Primary Teaching</image:title>
      <image:caption>Book cover of: Effective Primary Teaching. By: Paul Croll</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietrich-dietrich-max-plank-institutfur-wissenschaftsgeschichte-berlin-edition-axel-menges-9783932565748-opus-74-andreas-sch-tzke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783932565748.jpg?v=1767770698</image:loc>
      <image:title>Dietrich &amp; Dietrich Max-Plank-Institutfur Wissenschaftsgeschichte, Berlin</image:title>
      <image:caption>Book cover of: Dietrich &amp; Dietrich Max-Plank-Institutfur Wissenschaftsgeschichte, Berlin. By: Andreas Schätzke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietland-atlantic-books-9781786496812-tv-tie-in-sarai-walker</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781786496812.jpg?v=1767770698</image:loc>
      <image:title>Dietland</image:title>
      <image:caption>Book cover of: Dietland. By: Sarai Walker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-school-district-leadership-state-university-of-new-york-press-9780791422540-transforming-politics-into-education-kenneth-leithwood</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-project-management-john-wiley-and-sons-ltd-9781119469445-guidance-and-checklists-for-engineering-and-construction-garth-g-f-ward</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781119469445.jpg?v=1767770699</image:loc>
      <image:title>Effective Project Management</image:title>
      <image:caption>Book cover of: Effective Project Management. By: Garth G.F. Ward</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-supplements-nova-science-publishers-inc-9781617612855-what-seniors-need-to-know-thomas-h-felton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781617612855.jpg?v=1767770699</image:loc>
      <image:title>Dietary Supplements</image:title>
      <image:caption>Book cover of: Dietary Supplements. By: Thomas H. Felton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-project-management-cengage-learning-inc-9780324658897-james-clements</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780324658897.jpg?v=1767770696</image:loc>
      <image:title>Effective Project Management</image:title>
      <image:caption>Book cover of: Effective Project Management. By: James Clements</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietetic-service-operation-handbook-taylor-francis-inc-9781560220275-practical-applications-in-geriatric-care</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781560220275.jpg?v=1767770696</image:loc>
      <image:title>Dietetic Service Operation Handbook</image:title>
      <image:caption>Book cover of: Dietetic Service Operation Handbook</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-primary-school-classroom-taylor-francis-ltd-9780415344630-the-essential-guide-for-new-teachers-joan-dean</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415344630.jpg?v=1767770696</image:loc>
      <image:title>Effective Primary School Classroom</image:title>
      <image:caption>Book cover of: Effective Primary School Classroom. By: Joan Dean</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-project-management-through-applied-cost-and-schedule-control-taylor-francis-inc-9780824797157</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780824797157.jpg?v=1767770698</image:loc>
      <image:title>Effective Project Management Through Applied Cost and Schedule Control</image:title>
      <image:caption>Book cover of: Effective Project Management Through Applied Cost and Schedule Control</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-supplements-nova-science-publishers-inc-9781590337196-current-issues-donna-viola-porter</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781590337196.jpg?v=1767770701</image:loc>
      <image:title>Dietary Supplements</image:title>
      <image:caption>Book cover of: Dietary Supplements. By: Donna Viola Porter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-programs-for-latino-students-taylor-francis-inc-9780805834123</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805834123.jpg?v=1767770697</image:loc>
      <image:title>Effective Programs for Latino Students</image:title>
      <image:caption>Book cover of: Effective Programs for Latino Students</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-practice-in-spatial-planning-taylor-francis-ltd-9780415492829-janice-morphet</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415492829.jpg?v=1767770698</image:loc>
      <image:title>Effective Practice in Spatial Planning</image:title>
      <image:caption>Book cover of: Effective Practice in Spatial Planning. By: Janice Morphet</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-supplements-for-the-health-and-quality-of-cultured-fish-cabi-publishing-9781845931995</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781845931995.jpg?v=1767770700</image:loc>
      <image:title>Dietary Supplements for the Health and Quality of Cultured Fish</image:title>
      <image:caption>Book cover of: Dietary Supplements for the Health and Quality of Cultured Fish</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-practice-for-adolescents-with-reading-and-literacy-challenges-taylor-francis-ltd-9780415957373-denti-guerin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415957373.jpg?v=1767770697</image:loc>
      <image:title>Effective Practice for Adolescents with Reading and Literacy Challenges</image:title>
      <image:caption>Book cover of: Effective Practice for Adolescents with Reading and Literacy Challenges. By: Denti. Guerin.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-press-relations-for-the-built-environment-taylor-francis-ltd-9780415348676-a-practical-guide-helen-elias</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415348676.jpg?v=1767770699</image:loc>
      <image:title>Effective Press Relations for the Built Environment</image:title>
      <image:caption>Book cover of: Effective Press Relations for the Built Environment. By: Helen Elias</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-protagonist-in-the-nineteenth-century-british-novel-taylor-francis-ltd-9780754641353-scott-bronte-eliot-wilde-terence-dawson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780754641353.jpg?v=1767770698</image:loc>
      <image:title>Effective Protagonist in the Nineteenth-Century British Novel</image:title>
      <image:caption>Book cover of: Effective Protagonist in the Nineteenth-Century British Novel. By: Terence Dawson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-sugars-and-health-taylor-francis-inc-9781466593770-michael-i-goran</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781466593770.jpg?v=1767770697</image:loc>
      <image:title>Dietary Sugars and Health</image:title>
      <image:caption>Book cover of: Dietary Sugars and Health. By: Michael I. Goran</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-project-management-john-wiley-sons-inc-9781119562801-traditional-agile-extreme-hybrid-robert-k-wysocki</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781119562801.jpg?v=1767770697</image:loc>
      <image:title>Effective Project Management</image:title>
      <image:caption>Book cover of: Effective Project Management. By: Robert K. Wysocki</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-programs-for-latino-students-taylor-francis-inc-9780805834130</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805834130.jpg?v=1767770699</image:loc>
      <image:title>Effective Programs for Latino Students</image:title>
      <image:caption>Book cover of: Effective Programs for Latino Students</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-supplements-in-health-promotion-taylor-francis-inc-9781482210347-taylor-c-wallace</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781482210347.jpg?v=1767770700</image:loc>
      <image:title>Dietary Supplements in Health Promotion</image:title>
      <image:caption>Book cover of: Dietary Supplements in Health Promotion. By: Taylor C. Wallace</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-supplement-good-manufacturing-practices-taylor-francis-inc-9781420077407-preparing-for-compliance-william-j-mead</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781420077407.jpg?v=1767770700</image:loc>
      <image:title>Dietary Supplement Good Manufacturing Practices</image:title>
      <image:caption>Book cover of: Dietary Supplement Good Manufacturing Practices. By: William J. Mead</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-practice-in-spatial-planning-taylor-francis-ltd-9780415492812-janice-morphet</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415492812.jpg?v=1767770699</image:loc>
      <image:title>Effective Practice in Spatial Planning</image:title>
      <image:caption>Book cover of: Effective Practice in Spatial Planning. By: Janice Morphet</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-practice-for-adolescents-with-reading-and-literacy-challenges-taylor-francis-ltd-9780415957366-denti-guerin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415957366.jpg?v=1767770697</image:loc>
      <image:title>Effective Practice for Adolescents with Reading and Literacy Challenges</image:title>
      <image:caption>Book cover of: Effective Practice for Adolescents with Reading and Literacy Challenges. By: Denti. Guerin.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-supplements-nova-science-publishers-inc-9781629489339-regulation-policy-issues-emerging-trends-kenneth-h-ponce</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781629489339.jpg?v=1767770698</image:loc>
      <image:title>Dietary Supplements</image:title>
      <image:caption>Book cover of: Dietary Supplements. By: Kenneth H. Ponce</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-press-relations-for-the-built-environment-taylor-francis-ltd-9780415348669-a-practical-guide-helen-elias</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415348669.jpg?v=1767770702</image:loc>
      <image:title>Effective Press Relations for the Built Environment</image:title>
      <image:caption>Book cover of: Effective Press Relations for the Built Environment. By: Helen Elias</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-sugars-royal-society-of-chemistry-9781849733700-chemistry-analysis-function-and-effects-victor-r-preedy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781849733700.jpg?v=1767770698</image:loc>
      <image:title>Dietary Sugars</image:title>
      <image:caption>Book cover of: Dietary Sugars. By: Victor R. Preedy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-plant-products-human-health-nova-science-publishers-inc-9781612096728-new-evidences-about-the-effects-on-degenerative-diseases-mauro-serafini</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781612096728.jpg?v=1767770698</image:loc>
      <image:title>Dietary Plant Products &amp; Human Health</image:title>
      <image:caption>Book cover of: Dietary Plant Products &amp; Human Health. By: Mauro Serafini</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-planning-strategies-and-proposal-writing-university-press-of-america-9780761849766-a-workbook-for-helping-professionals</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761849766.jpg?v=1767770699</image:loc>
      <image:title>Effective Planning Strategies and Proposal Writing</image:title>
      <image:caption>Book cover of: Effective Planning Strategies and Proposal Writing</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-supplements-nova-science-publishers-inc-9781607418917-primer-fda-oversight</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781607418917.jpg?v=1767770701</image:loc>
      <image:title>Dietary Supplements</image:title>
      <image:caption>Book cover of: Dietary Supplements</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-proteins-and-atherosclerosis-taylor-francis-ltd-9780367394790-g-debry</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367394790.jpg?v=1767770701</image:loc>
      <image:title>Dietary Proteins and Atherosclerosis</image:title>
      <image:caption>Book cover of: Dietary Proteins and Atherosclerosis. By: G. Debry</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-supplementation-in-sport-and-exercise-taylor-francis-ltd-9781138610842-evidence-safety-and-ergogenic-benefits-jay-r-hoffman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138610842.jpg?v=1767770698</image:loc>
      <image:title>Dietary Supplementation in Sport and Exercise</image:title>
      <image:caption>Book cover of: Dietary Supplementation in Sport and Exercise. By: Jay R. Hoffman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-patterns-and-whole-plant-foods-in-aging-and-disease-springer-nature-switzerland-ag-9783030096410-mark-l-dreher</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783030096410.jpg?v=1767770700</image:loc>
      <image:title>Dietary Patterns and Whole Plant Foods in Aging and Disease</image:title>
      <image:caption>Book cover of: Dietary Patterns and Whole Plant Foods in Aging and Disease. By: Mark L. Dreher</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-supplementation-in-sport-and-exercise-taylor-francis-ltd-9781138610835-evidence-safety-and-ergogenic-benefits-jay-r-hoffman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138610835.jpg?v=1767770699</image:loc>
      <image:title>Dietary Supplementation in Sport and Exercise</image:title>
      <image:caption>Book cover of: Dietary Supplementation in Sport and Exercise. By: Jay R. Hoffman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-magnesium-nova-science-publishers-inc-9781606921098-new-research</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781606921098.jpg?v=1767770699</image:loc>
      <image:title>Dietary Magnesium</image:title>
      <image:caption>Book cover of: Dietary Magnesium</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-parenting-for-the-hard-to-manage-child-taylor-francis-ltd-9781138131033-a-skills-based-book-georgia-a-degangi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138131033.jpg?v=1767770699</image:loc>
      <image:title>Effective Parenting for the Hard-to-Manage Child</image:title>
      <image:caption>Book cover of: Effective Parenting for the Hard-to-Manage Child. By: Georgia A. DeGangi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-peer-learning-taylor-francis-ltd-9781138906488-from-principles-to-practical-implementation-keith-topping</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138906488.jpg?v=1767770701</image:loc>
      <image:title>Effective Peer Learning</image:title>
      <image:caption>Book cover of: Effective Peer Learning. By: Keith Topping</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-guide-nova-science-publishers-inc-9781594546549</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781594546549.jpg?v=1767770703</image:loc>
      <image:title>Dietary Guide</image:title>
      <image:caption>Book cover of: Dietary Guide</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-phosphorus-taylor-francis-inc-9781498706964-health-nutrition-and-regulatory-aspects-jaime-uribarri</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781498706964.jpg?v=1767770700</image:loc>
      <image:title>Dietary Phosphorus</image:title>
      <image:caption>Book cover of: Dietary Phosphorus. By: Jaime Uribarri</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-flavonoids-interfere-with-cancer-radiotherapy-nova-science-publishers-inc-9781536167801-katrin-sak</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781536167801.jpg?v=1767770699</image:loc>
      <image:title>Dietary Flavonoids Interfere with Cancer Radiotherapy</image:title>
      <image:caption>Book cover of: Dietary Flavonoids Interfere with Cancer Radiotherapy. By: Katrin Sak</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-protein-research-trends-nova-science-publishers-inc-9781600216077-janet-r-ling</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781600216077.jpg?v=1767770702</image:loc>
      <image:title>Dietary Protein Research Trends</image:title>
      <image:caption>Book cover of: Dietary Protein Research Trends. By: Janet R. Ling</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-nonprofit-management-taylor-francis-ltd-9780765630308-context-and-environment-joan-e-pynes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780765630308.jpg?v=1767770699</image:loc>
      <image:title>Effective Nonprofit Management</image:title>
      <image:caption>Book cover of: Effective Nonprofit Management. By: Joan E. Pynes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-patterns-food-chemistry-and-human-health-springer-nature-switzerland-ag-9783030146535-suresh-d-sharma</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783030146535.jpg?v=1767770700</image:loc>
      <image:title>Dietary Patterns, Food Chemistry and Human Health</image:title>
      <image:caption>Book cover of: Dietary Patterns, Food Chemistry and Human Health. By: Suresh D. Sharma</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-peer-learning-taylor-francis-ltd-9781138906495-from-principles-to-practical-implementation-keith-topping</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138906495.jpg?v=1767770700</image:loc>
      <image:title>Effective Peer Learning</image:title>
      <image:caption>Book cover of: Effective Peer Learning. By: Keith Topping</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-meetings-for-managers-taylor-francis-ltd-9780080464398-institute-of-leadership-management-ilm</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780080464398.jpg?v=1767770699</image:loc>
      <image:title>Effective Meetings for Managers</image:title>
      <image:caption>Book cover of: Effective Meetings for Managers. By: Institute of Leadership &amp; Management (ILM)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-protein-and-resistance-exercise-taylor-francis-inc-9781439844564-lonnie-michael-lowery</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781439844564.jpg?v=1767770701</image:loc>
      <image:title>Dietary Protein and Resistance Exercise</image:title>
      <image:caption>Book cover of: Dietary Protein and Resistance Exercise. By: Lonnie Michael Lowery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-organizational-change-taylor-francis-ltd-9780415747738-leading-through-sensemaking-einar-iveroth</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415747738.jpg?v=1767770700</image:loc>
      <image:title>Effective Organizational Change</image:title>
      <image:caption>Book cover of: Effective Organizational Change. By: Einar Iveroth</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-interventions-in-autism-spectrum-disorders-jessica-kingsley-publishers-9781843109396-why-they-work-when-they-do-why-they-don-t-when-they-don-t-kenneth-j-aitken</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781843109396.jpg?v=1767770703</image:loc>
      <image:title>Dietary Interventions in Autism Spectrum Disorders</image:title>
      <image:caption>Book cover of: Dietary Interventions in Autism Spectrum Disorders. By: Kenneth J. Aitken</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-manager-sage-publications-inc-9780761951117-perspectives-and-illustrations-jon-billsberry</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761951117.jpg?v=1767770699</image:loc>
      <image:title>Effective Manager</image:title>
      <image:caption>Book cover of: Effective Manager. By: Jon Billsberry</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-risk-factors-of-cardiovascular-diseases-nova-science-publishers-inc-9781634827614-wenbiao-wu</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781634827614.jpg?v=1767770700</image:loc>
      <image:title>Dietary Risk Factors of Cardiovascular Diseases</image:title>
      <image:caption>Book cover of: Dietary Risk Factors of Cardiovascular Diseases. By: Wenbiao Wu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-management-of-benchmarking-projects-taylor-francis-ltd-9780750639873</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750639873.jpg?v=1767770700</image:loc>
      <image:title>Effective Management of Benchmarking Projects</image:title>
      <image:caption>Book cover of: Effective Management of Benchmarking Projects</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-mathematics-of-the-uncountable-cambridge-university-press-9781107014510-noam-greenberg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781107014510.jpg?v=1767770700</image:loc>
      <image:title>Effective Mathematics of the Uncountable</image:title>
      <image:caption>Book cover of: Effective Mathematics of the Uncountable. By: Noam Greenberg</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-online-searching-taylor-francis-inc-9780824771423-a-basic-text</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780824771423.jpg?v=1767770701</image:loc>
      <image:title>Effective Online Searching</image:title>
      <image:caption>Book cover of: Effective Online Searching</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-supplements-humana-press-inc-9781468497267-toxicology-and-clinical-pharmacology-melanie-johns-cupp</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781468497267.jpg?v=1767770701</image:loc>
      <image:title>Dietary Supplements</image:title>
      <image:caption>Book cover of: Dietary Supplements. By: Melanie Johns Cupp</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-fiber-in-health-and-disease-birkhauser-verlag-ag-9783319505558-mark-dreher</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783319505558.jpg?v=1767770702</image:loc>
      <image:title>Dietary Fiber in Health and Disease</image:title>
      <image:caption>Book cover of: Dietary Fiber in Health and Disease. By: Mark Dreher</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-organization-taylor-francis-ltd-9780415880367-practical-application-of-complexity-theory-and-organizational-design-to-maximize-performance-in-the-face-of-emerging-events-dennis-tafoya</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415880367.jpg?v=1767770700</image:loc>
      <image:title>Effective Organization</image:title>
      <image:caption>Book cover of: Effective Organization. By: Dennis Tafoya</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-ages-and-their-role-in-health-and-disease-taylor-francis-inc-9781498721516-jaime-uribarri</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781498721516.jpg?v=1767770702</image:loc>
      <image:title>Dietary AGEs and Their Role in Health and Disease</image:title>
      <image:caption>Book cover of: Dietary AGEs and Their Role in Health and Disease. By: Jaime Uribarri</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-opportunity-management-for-projects-taylor-francis-inc-9780824748081-exploiting-positive-risk-david-hillson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780824748081.jpg?v=1767770700</image:loc>
      <image:title>Effective Opportunity Management for Projects</image:title>
      <image:caption>Book cover of: Effective Opportunity Management for Projects. By: David Hillson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-fibre-john-libbey-eurotext-9782742000968-mechanisms-of-action-in-human-physiology-metabolism-c-cherbut</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9782742000968.jpg?v=1767770702</image:loc>
      <image:title>Dietary Fibre</image:title>
      <image:caption>Book cover of: Dietary Fibre. By: C. Cherbut</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-nutrition-and-fetal-programming-birkhauser-verlag-ag-9783319868264-rajkumar-rajendram</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783319868264.jpg?v=1767770701</image:loc>
      <image:title>Diet, Nutrition, and Fetal Programming</image:title>
      <image:caption>Book cover of: Diet, Nutrition, and Fetal Programming. By: Rajkumar Rajendram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-maintenance-management-industrial-press-inc-u-s-9780831134440-vee-narayan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780831134440.jpg?v=1767770701</image:loc>
      <image:title>Effective Maintenance Management</image:title>
      <image:caption>Book cover of: Effective Maintenance Management. By: Vee Narayan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-nonprofit-management-taylor-francis-ltd-9780765630292-context-and-environment-joan-pynes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780765630292.jpg?v=1767770702</image:loc>
      <image:title>Effective Nonprofit Management</image:title>
      <image:caption>Book cover of: Effective Nonprofit Management. By: Joan Pynes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-organizational-change-taylor-francis-ltd-9780415747721-leading-through-sensemaking-einar-iveroth</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415747721.jpg?v=1767770700</image:loc>
      <image:title>Effective Organizational Change</image:title>
      <image:caption>Book cover of: Effective Organizational Change. By: Einar Iveroth</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-fiber-fruit-vegetable-consumption-health-nova-science-publishers-inc-9781608760251</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781608760251.jpg?v=1767770706</image:loc>
      <image:title>Dietary Fiber, Fruit &amp; Vegetable Consumption &amp; Health</image:title>
      <image:caption>Book cover of: Dietary Fiber, Fruit &amp; Vegetable Consumption &amp; Health</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-fiber-nova-science-publishers-inc-9781634636551-production-challenges-food-sources-health-benefits-marvin-e-clemens</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781634636551.jpg?v=1767770702</image:loc>
      <image:title>Dietary Fiber</image:title>
      <image:caption>Book cover of: Dietary Fiber. By: Marvin E. Clemens</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-fiber-and-health-taylor-francis-inc-9781439899298-sungsoo-cho</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781439899298.jpg?v=1767770701</image:loc>
      <image:title>Dietary Fiber and Health</image:title>
      <image:caption>Book cover of: Dietary Fiber and Health. By: Sungsoo Cho</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dietary-components-and-immune-function-humana-press-inc-9781493958184-ronald-ross-watson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781493958184.jpg?v=1767770703</image:loc>
      <image:title>Dietary Components and Immune Function</image:title>
      <image:caption>Book cover of: Dietary Components and Immune Function. By: Ronald Ross Watson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-nutrition-and-cancer-a-critical-evaluation-taylor-francis-ltd-9781315892306-volume-i-bandaru-s-reddy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781315892306.jpg?v=1767770702</image:loc>
      <image:title>Diet, Nutrition and Cancer: A Critical Evaluation</image:title>
      <image:caption>Book cover of: Diet, Nutrition and Cancer: A Critical Evaluation. By: Bandaru S. Reddy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-library-and-information-centre-management-taylor-francis-ltd-9780566076916</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780566076916.jpg?v=1767770703</image:loc>
      <image:title>Effective Library and Information Centre Management</image:title>
      <image:caption>Book cover of: Effective Library and Information Centre Management</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-parenting-for-the-hard-to-manage-child-taylor-francis-ltd-9780415955461-a-skills-based-book-georgia-degangi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415955461.jpg?v=1767770701</image:loc>
      <image:title>Effective Parenting for the Hard-to-Manage Child</image:title>
      <image:caption>Book cover of: Effective Parenting for the Hard-to-Manage Child. By: Georgia DeGangi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-law-taylor-francis-ltd-9781138158900-roger-burridge</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138158900.jpg?v=1767770700</image:loc>
      <image:title>Effective Learning and Teaching in Law</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Law. By: Roger Burridge</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-social-policy-and-social-work-taylor-francis-ltd-9780415334969</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415334969.jpg?v=1767770701</image:loc>
      <image:title>Effective Learning and Teaching in Social Policy and Social Work</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Social Policy and Social Work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-modern-languages-taylor-francis-ltd-9780415346634-jim-coleman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415346634.jpg?v=1767770701</image:loc>
      <image:title>Effective Learning and Teaching in Modern Languages</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Modern Languages. By: Jim Coleman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-social-policy-and-social-work-taylor-francis-ltd-9780415334952</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415334952.jpg?v=1767770703</image:loc>
      <image:title>Effective Learning and Teaching in Social Policy and Social Work</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Social Policy and Social Work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-mathematics-and-its-applications-taylor-francis-ltd-9781138145481-peter-kahn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138145481.jpg?v=1767770703</image:loc>
      <image:title>Effective Learning and Teaching in Mathematics and Its Applications</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Mathematics and Its Applications. By: Peter Kahn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-men-s-ministry-zondervan-9780310236368-the-indispensable-toolkit-for-your-church-phil-downer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780310236368.jpg?v=1767770702</image:loc>
      <image:title>Effective Men&apos;s Ministry</image:title>
      <image:caption>Book cover of: Effective Men&apos;s Ministry. By: Phil Downer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-modern-languages-taylor-francis-ltd-9780415346641-jim-coleman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415346641.jpg?v=1767770703</image:loc>
      <image:title>Effective Learning and Teaching in Modern Languages</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Modern Languages. By: Jim Coleman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-leas-and-school-improvement-taylor-francis-ltd-9780415232661</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415232661.jpg?v=1767770703</image:loc>
      <image:title>Effective LEAs and School Improvement</image:title>
      <image:caption>Book cover of: Effective LEAs and School Improvement</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-in-the-life-sciences-john-wiley-sons-inc-9780470661574-how-students-can-achieve-their-full-potential-david-j-adams</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780470661574.jpg?v=1767770701</image:loc>
      <image:title>Effective Learning in the Life Sciences</image:title>
      <image:caption>Book cover of: Effective Learning in the Life Sciences. By: David J. Adams</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-organization-taylor-francis-ltd-9780415880350-practical-application-of-complexity-theory-and-organizational-design-to-maximize-performance-in-the-face-of-emerging-events-dennis-tafoya</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415880350.jpg?v=1767770703</image:loc>
      <image:title>Effective Organization</image:title>
      <image:caption>Book cover of: Effective Organization. By: Dennis Tafoya</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-engineering-taylor-francis-ltd-9780415334884</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415334884.jpg?v=1767770703</image:loc>
      <image:title>Effective Learning and Teaching in Engineering</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Engineering</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-literacy-coach-teachers-college-press-9780807748015-using-inquiry-to-support-teaching-and-learning-adrian-rodgers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780807748015.jpg?v=1767770702</image:loc>
      <image:title>Effective Literacy Coach</image:title>
      <image:caption>Book cover of: Effective Literacy Coach. By: Adrian Rodgers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-mathematics-and-its-applications-kogan-page-ltd-9780749435691</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780749435691.jpg?v=1767770704</image:loc>
      <image:title>Effective Learning and Teaching in Mathematics and Its Applications</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Mathematics and Its Applications</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-leas-and-school-improvement-taylor-francis-ltd-9780415232654</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415232654.jpg?v=1767770701</image:loc>
      <image:title>Effective LEAs and School Improvement</image:title>
      <image:caption>Book cover of: Effective LEAs and School Improvement</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-medium-theory-oxford-university-press-9780198705093-principles-and-applications-tuck-c-choy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780198705093.jpg?v=1767770705</image:loc>
      <image:title>Effective Medium Theory</image:title>
      <image:caption>Book cover of: Effective Medium Theory. By: Tuck C. Choy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-brain-behavior-taylor-francis-inc-9781439821565-practical-implications-harris-r-lieberman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781439821565.jpg?v=1767770705</image:loc>
      <image:title>Diet, Brain, Behavior</image:title>
      <image:caption>Book cover of: Diet, Brain, Behavior. By: Harris R. Lieberman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-engineering-taylor-francis-ltd-9780415334891</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415334891.jpg?v=1767770702</image:loc>
      <image:title>Effective Learning and Teaching in Engineering</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Engineering</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-business-and-management-kogan-page-ltd-9780749434489</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780749434489.jpg?v=1767770702</image:loc>
      <image:title>Effective Learning and Teaching in Business and Management</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Business and Management</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-computing-taylor-francis-ltd-9780415335010</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415335010.jpg?v=1767770702</image:loc>
      <image:title>Effective Learning and Teaching in Computing</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Computing</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-nutrients-and-bone-health-taylor-francis-ltd-9780367382292-john-j-b-ph-d-anderson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367382292.jpg?v=1767770704</image:loc>
      <image:title>Diet, Nutrients, and Bone Health</image:title>
      <image:caption>Book cover of: Diet, Nutrients, and Bone Health. By: John J.B., Ph.D. Anderson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-quality-of-american-school-age-children-nova-science-publishers-inc-9781606927762-kelly-b-volkarsky</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781606927762.jpg?v=1767770705</image:loc>
      <image:title>Diet Quality of American School-Age Children</image:title>
      <image:caption>Book cover of: Diet Quality of American School-Age Children. By: Kelly B. Volkarsky</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-leadership-in-the-family-business-palgrave-macmillan-9780230111172-craig-e-aronoff</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780230111172.jpg?v=1767770702</image:loc>
      <image:title>Effective Leadership in the Family Business</image:title>
      <image:caption>Book cover of: Effective Leadership in the Family Business. By: Craig E. Aronoff</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-exercise-and-chronic-disease-taylor-francis-inc-9781439850282-the-biological-basis-of-prevention-c-murray-ardies</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781439850282.jpg?v=1767770703</image:loc>
      <image:title>Diet, Exercise, and Chronic Disease</image:title>
      <image:caption>Book cover of: Diet, Exercise, and Chronic Disease. By: C. Murray Ardies</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-computing-taylor-francis-ltd-9780415335003</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415335003.jpg?v=1767770702</image:loc>
      <image:title>Effective Learning and Teaching in Computing</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Computing</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-nutrition-and-cancer-a-critical-evaluation-taylor-francis-ltd-9781315892283-volume-ii-bandaru-s-reddy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781315892283.jpg?v=1767770703</image:loc>
      <image:title>Diet, Nutrition and Cancer: A Critical Evaluation</image:title>
      <image:caption>Book cover of: Diet, Nutrition and Cancer: A Critical Evaluation. By: Bandaru S. Reddy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-after-acquired-brain-injury-taylor-francis-ltd-9781138816602-a-practical-guide-to-support-adults-with-neurological-conditions-graham-lowings</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138816602.jpg?v=1767770703</image:loc>
      <image:title>Effective Learning after Acquired Brain Injury</image:title>
      <image:caption>Book cover of: Effective Learning after Acquired Brain Injury. By: Graham Lowings</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-leadership-masterclass-pan-macmillan-9780330509442-secrets-of-success-from-the-world-s-greatest-leaders-adair-john</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780330509442.jpg?v=1767770704</image:loc>
      <image:title>Effective Leadership Masterclass</image:title>
      <image:caption>Book cover of: Effective Leadership Masterclass. By: Adair, John</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-quality-of-american-young-children-nova-science-publishers-inc-9781606927717</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781606927717.jpg?v=1767770705</image:loc>
      <image:title>Diet Quality of American Young Children</image:title>
      <image:caption>Book cover of: Diet Quality of American Young Children</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-leadership-for-school-improvement-taylor-francis-ltd-9780415242233</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415242233.jpg?v=1767770707</image:loc>
      <image:title>Effective Leadership for School Improvement</image:title>
      <image:caption>Book cover of: Effective Leadership for School Improvement</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-nutrition-and-fetal-programming-birkhauser-verlag-ag-9783319602875-rajkumar-rajendram</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783319602875.jpg?v=1767770704</image:loc>
      <image:title>Diet, Nutrition, and Fetal Programming</image:title>
      <image:caption>Book cover of: Diet, Nutrition, and Fetal Programming. By: Rajkumar Rajendram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-quality-humana-press-inc-9781461473381-an-evidence-based-approach-volume-1-victor-r-preedy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781461473381.jpg?v=1767770702</image:loc>
      <image:title>Diet Quality</image:title>
      <image:caption>Book cover of: Diet Quality. By: Victor R. Preedy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-and-teaching-in-medical-dental-and-veterinary-education-taylor-francis-ltd-9781138151345-sharon-huttly</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138151345.jpg?v=1767770702</image:loc>
      <image:title>Effective Learning and Teaching in Medical, Dental and Veterinary Education</image:title>
      <image:caption>Book cover of: Effective Learning and Teaching in Medical, Dental and Veterinary Education. By: Sharon Huttly</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-nutrients-and-bone-health-taylor-francis-inc-9781439819555-john-j-b-ph-d-anderson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781439819555.jpg?v=1767770707</image:loc>
      <image:title>Diet, Nutrients, and Bone Health</image:title>
      <image:caption>Book cover of: Diet, Nutrients, and Bone Health. By: John J.B., Ph.D. Anderson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-interventions-for-unemployed-young-people-in-europe-taylor-francis-ltd-9780367350109-social-innovation-or-paradigm-shift-tom-s-sirov-tka</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367350109.jpg?v=1767770705</image:loc>
      <image:title>Effective Interventions for Unemployed Young People in Europe</image:title>
      <image:caption>Book cover of: Effective Interventions for Unemployed Young People in Europe. By: Tomás Sirovátka</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-leadership-new-revised-edition-pan-macmillan-9780330504195-how-to-be-a-successful-leader-john-eric-adair</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780330504195.jpg?v=1767770703</image:loc>
      <image:title>Effective Leadership (NEW REVISED EDITION)</image:title>
      <image:caption>Book cover of: Effective Leadership (NEW REVISED EDITION). By: John Eric Adair</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-leadership-taylor-francis-ltd-9780415763400-strategies-for-maximizing-executive-productivity-and-health-len-sperry</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415763400.jpg?v=1767770704</image:loc>
      <image:title>Effective Leadership</image:title>
      <image:caption>Book cover of: Effective Leadership. By: Len Sperry</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-quality-of-americans-nova-science-publishers-inc-9781606927779-nancy-cole</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781606927779.jpg?v=1767770705</image:loc>
      <image:title>Diet Quality of Americans</image:title>
      <image:caption>Book cover of: Diet Quality of Americans. By: Nancy Cole</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-learning-after-acquired-brain-injury-taylor-francis-ltd-9781138816619-a-practical-guide-to-support-adults-with-neurological-conditions-graham-lowings</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138816619.jpg?v=1767770703</image:loc>
      <image:title>Effective Learning after Acquired Brain Injury</image:title>
      <image:caption>Book cover of: Effective Learning after Acquired Brain Injury. By: Graham Lowings</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-pills-the-internet-nova-science-publishers-inc-9781620814208-terence-m-dovey</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781620814208.jpg?v=1767770706</image:loc>
      <image:title>Diet Pills &amp; the Internet</image:title>
      <image:caption>Book cover of: Diet Pills &amp; the Internet. By: Terence M. Dovey</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-therapy-research-trends-nova-science-publishers-inc-9781600216701-francis-p-robitaille</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781600216701.jpg?v=1767770704</image:loc>
      <image:title>Diet Therapy Research Trends</image:title>
      <image:caption>Book cover of: Diet Therapy Research Trends. By: Francis P. Robitaille</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-intervention-and-autism-jessica-kingsley-publishers-9781853029356-implementing-the-gluten-free-and-casein-free-diet-for-autistic-children-and-adults-a-practical-guide-for-parents-marilyn-le-breton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781853029356.jpg?v=1767770709</image:loc>
      <image:title>Diet Intervention and Autism</image:title>
      <image:caption>Book cover of: Diet Intervention and Autism. By: Marilyn Le Breton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-quality-humana-press-inc-9781493948741-an-evidence-based-approach-volume-2-victor-r-preedy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781493948741.jpg?v=1767770704</image:loc>
      <image:title>Diet Quality</image:title>
      <image:caption>Book cover of: Diet Quality. By: Victor R. Preedy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-innovation-in-the-secondary-geography-curriculum-taylor-francis-ltd-9780415519069-a-practical-guide-charles-rawding</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415519069.jpg?v=1767770705</image:loc>
      <image:title>Effective Innovation in the Secondary Geography Curriculum</image:title>
      <image:caption>Book cover of: Effective Innovation in the Secondary Geography Curriculum. By: Charles Rawding</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-quality-humana-press-inc-9781461473145-an-evidence-based-approach-volume-2-victor-r-preedy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781461473145.jpg?v=1767770706</image:loc>
      <image:title>Diet Quality</image:title>
      <image:caption>Book cover of: Diet Quality. By: Victor R. Preedy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-intervention-in-primary-schools-taylor-francis-ltd-9781138130630-nurture-groups</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138130630.jpg?v=1767770704</image:loc>
      <image:title>Effective Intervention in Primary Schools</image:title>
      <image:caption>Book cover of: Effective Intervention in Primary Schools</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-leadership-for-school-improvement-taylor-francis-ltd-9780415300469</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415300469.jpg?v=1767770704</image:loc>
      <image:title>Effective Leadership for School Improvement</image:title>
      <image:caption>Book cover of: Effective Leadership for School Improvement</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-and-human-immune-function-humana-press-inc-9781588292063</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781588292063.jpg?v=1767770705</image:loc>
      <image:title>Diet and Human Immune Function</image:title>
      <image:caption>Book cover of: Diet and Human Immune Function</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-quality-humana-press-inc-9781493942596-an-evidence-based-approach-volume-1-victor-r-preedy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781493942596.jpg?v=1767770707</image:loc>
      <image:title>Diet Quality</image:title>
      <image:caption>Book cover of: Diet Quality. By: Victor R. Preedy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-essentials-at-a-glance-aracaria-biodynamic-farm-9780980843354</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780980843354.jpg?v=1767770707</image:loc>
      <image:title>Diet Essentials at a Glance</image:title>
      <image:caption>Book cover of: Diet Essentials at a Glance</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-interventions-for-children-in-need-taylor-francis-ltd-9780754628255</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780754628255.jpg?v=1767770704</image:loc>
      <image:title>Effective Interventions for Children in Need</image:title>
      <image:caption>Book cover of: Effective Interventions for Children in Need</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-java-pearson-education-us-9780134685991-bloch-joshua</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780134685991.jpg?v=1767770704</image:loc>
      <image:title>Effective Java</image:title>
      <image:caption>Book cover of: Effective Java. By: BLOCH, JOSHUA</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-judicial-review-oxford-university-press-9780199581054-a-cornerstone-of-good-governance-c-f-forsyth</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780199581054.jpg?v=1767770706</image:loc>
      <image:title>Effective Judicial Review</image:title>
      <image:caption>Book cover of: Effective Judicial Review. By: C. F. Forsyth</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-implementation-in-practice-john-wiley-sons-inc-9781118775486-integrating-public-policy-and-management</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781118775486.jpg?v=1767770705</image:loc>
      <image:title>Effective Implementation In Practice</image:title>
      <image:caption>Book cover of: Effective Implementation In Practice</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-brain-connections-springer-verlag-new-york-inc-9781461353782-impact-on-memory-mood-aging-and-disease-mark-p-mattson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781461353782.jpg?v=1767770707</image:loc>
      <image:title>Diet — Brain Connections</image:title>
      <image:caption>Book cover of: Diet — Brain Connections. By: Mark P. Mattson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-intercultural-communication-a-christian-perspective-baker-publishing-group-9780801026638</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780801026638.jpg?v=1767770705</image:loc>
      <image:title>Effective Intercultural Communication – A Christian Perspective</image:title>
      <image:caption>Book cover of: Effective Intercultural Communication – A Christian Perspective</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-innovation-in-the-secondary-geography-curriculum-taylor-francis-ltd-9780415519052-a-practical-guide-charles-rawding</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415519052.jpg?v=1767770706</image:loc>
      <image:title>Effective Innovation in the Secondary Geography Curriculum</image:title>
      <image:caption>Book cover of: Effective Innovation in the Secondary Geography Curriculum. By: Charles Rawding</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-grant-writing-and-program-evaluation-for-human-service-professionals-john-wiley-sons-inc-9780470469989-francis-k-o-yuen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780470469989.jpg?v=1767770705</image:loc>
      <image:title>Effective Grant Writing and Program Evaluation for Human Service Professionals</image:title>
      <image:caption>Book cover of: Effective Grant Writing and Program Evaluation for Human Service Professionals. By: Francis K. O. Yuen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-hr-communication-kogan-page-ltd-9780749476168-a-framework-for-communicating-hr-programmes-with-impact-debra-corey</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780749476168.jpg?v=1767770708</image:loc>
      <image:title>Effective HR Communication</image:title>
      <image:caption>Book cover of: Effective HR Communication. By: Debra Corey</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-grading-john-wiley-sons-inc-9780470502150-a-tool-for-learning-and-assessment-in-college-barbara-e-fassler-walvoord</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780470502150.jpg?v=1767770706</image:loc>
      <image:title>Effective Grading</image:title>
      <image:caption>Book cover of: Effective Grading. By: Barbara E. Fassler Walvoord</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-international-joint-venture-management-practical-legal-insights-for-successful-organization-and-implementation-taylor-francis-ltd-9780765605474-practical-legal-insights-for-successful-organization-and-implementation</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780765605474.jpg?v=1767770707</image:loc>
      <image:title>Effective International Joint Venture Management: Practical Legal Insights for Successful Organization and Implementation</image:title>
      <image:caption>Book cover of: Effective International Joint Venture Management: Practical Legal Insights for Successful Organization and Implementation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-nutrition-and-immunity-taylor-francis-ltd-9781315892290-r-armour-forse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781315892290.jpg?v=1767770711</image:loc>
      <image:title>Diet Nutrition and Immunity</image:title>
      <image:caption>Book cover of: Diet Nutrition and Immunity. By: R. Armour Forse</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-health-risk-messages-sage-publications-inc-9780761915096-a-step-by-step-guide-kim-witte</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761915096.jpg?v=1767770707</image:loc>
      <image:title>Effective Health Risk Messages</image:title>
      <image:caption>Book cover of: Effective Health Risk Messages. By: Kim Witte</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-groundwater-model-calibration-john-wiley-sons-inc-9780471776369-with-analysis-of-data-sensitivities-predictions-and-uncertainty-mary-c-hill-hill-mary-c</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780471776369.jpg?v=1767770706</image:loc>
      <image:title>Effective Groundwater Model Calibration</image:title>
      <image:caption>Book cover of: Effective Groundwater Model Calibration. By: Mary C. Hill, Hill, Mary C.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-fund-raising-management-taylor-francis-inc-9780805820102</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805820102.jpg?v=1767770709</image:loc>
      <image:title>Effective Fund-Raising Management</image:title>
      <image:caption>Book cover of: Effective Fund-Raising Management</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-group-coaching-john-wiley-sons-inc-9780470738542-tried-and-tested-tools-and-resources-for-optimum-coaching-results-marion-guzman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780470738542.jpg?v=1767770707</image:loc>
      <image:title>Effective Group Coaching</image:title>
      <image:caption>Book cover of: Effective Group Coaching. By: Marion Guzman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-recipes-b-jain-publishers-pvt-ltd-9788131912317-food-nutition</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9788131912317.jpg?v=1767770707</image:loc>
      <image:title>Diet &amp; Recipes</image:title>
      <image:caption>Book cover of: Diet &amp; Recipes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dienstleistungsokonomik-springer-verlag-berlin-and-heidelberg-gmbh-co-kg-9783658068264-betriebswirtschaftliche-und-volkswirtschaftliche-dimensionen-der-dienstleistungswirtschaft-hagen-kr-mer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-health-behavior-in-older-adults-springer-publishing-co-inc-9780826124012</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780826124012.jpg?v=1767770705</image:loc>
      <image:title>Effective Health Behavior in Older Adults</image:title>
      <image:caption>Book cover of: Effective Health Behavior in Older Adults</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dienstleistungsstandort-wien-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631373231-beschaeftigung-innovation-wettbewerbsfaehigkeit-eine-studie-im-auftrag-der-kammer-fuer-arbeiter-und-angestellte-fuer-wien-michael-mesch</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631373231.jpg?v=1767770704</image:loc>
      <image:title>Dienstleistungsstandort Wien</image:title>
      <image:caption>Book cover of: Dienstleistungsstandort Wien. By: Michael Mesch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-foundation-management-altamira-press-9780759109865-14-challenges-of-philanthropic-leadership-and-how-to-outfox-them-joel-j-orosz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780759109865.jpg?v=1767770708</image:loc>
      <image:title>Effective Foundation Management</image:title>
      <image:caption>Book cover of: Effective Foundation Management. By: Joel J. Orosz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-fund-raising-management-taylor-francis-inc-9780805813210</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805813210.jpg?v=1767770706</image:loc>
      <image:title>Effective Fund-Raising Management</image:title>
      <image:caption>Book cover of: Effective Fund-Raising Management</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-foundation-management-altamira-press-9780759109872-14-challenges-of-philanthropic-leadership-and-how-to-outfox-them-joel-j-orosz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780759109872.jpg?v=1767770707</image:loc>
      <image:title>Effective Foundation Management</image:title>
      <image:caption>Book cover of: Effective Foundation Management. By: Joel J. Orosz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diesel-companion-fernhurst-books-limited-9781912177950-pat-manley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781912177950.jpg?v=1767770709</image:loc>
      <image:title>Diesel Companion</image:title>
      <image:caption>Book cover of: Diesel Companion. By: Pat Manley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dienstleistungsunternehmen-im-internationalen-wettbewerb-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906753812-in-zusammenarbeit-mit-dem-wirtschaftswissenschaftlichen-zentrum-wwz-der-universitaet-basel</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906753812.jpg?v=1767770706</image:loc>
      <image:title>Dienstleistungsunternehmen im internationalen Wettbewerb</image:title>
      <image:caption>Book cover of: Dienstleistungsunternehmen im internationalen Wettbewerb</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-generational-ministry-biblical-and-practical-insights-for-transforming-church-communities-baker-publishing-group-9780801049484-elisabeth-a-nesbit-sbanotto</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780801049484.jpg?v=1767770706</image:loc>
      <image:title>Effective Generational Ministry - Biblical and Practical Insights for Transforming Church Communities</image:title>
      <image:caption>Book cover of: Effective Generational Ministry - Biblical and Practical Insights for Transforming Church Communities. By: Elisabeth A. Nesbit Sbanotto</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-in-class-support-taylor-francis-ltd-9781138164321-the-management-of-support-staff-in-mainstream-and-special-schools-stephanie-lorenz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138164321.jpg?v=1767770710</image:loc>
      <image:title>Effective In-Class Support</image:title>
      <image:caption>Book cover of: Effective In-Class Support. By: Stephanie Lorenz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dienstleistungsfreiheit-und-grenzueberschreitende-entsendung-von-arbeitnehmern-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631335178</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631335178.jpg?v=1767770709</image:loc>
      <image:title>Dienstleistungsfreiheit und grenzueberschreitende Entsendung von Arbeitnehmern</image:title>
      <image:caption>Book cover of: Dienstleistungsfreiheit und grenzueberschreitende Entsendung von Arbeitnehmern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dienstleistungssektor-und-dienstleistungspolitik-in-entwicklungslaendern-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631445662-eine-theoretische-und-empirische-analyse-mit-einer-fallstudie-der-asean-staaten</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631445662.jpg?v=1767770708</image:loc>
      <image:title>Dienstleistungssektor und Dienstleistungspolitik in Entwicklungslaendern</image:title>
      <image:caption>Book cover of: Dienstleistungssektor und Dienstleistungspolitik in Entwicklungslaendern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-recipes-b-jain-publishers-pvt-ltd-9788131912362</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9788131912362.jpg?v=1767770709</image:loc>
      <image:title>Diet &amp; Recipes</image:title>
      <image:caption>Book cover of: Diet &amp; Recipes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dielectrics-in-electric-fields-taylor-francis-inc-9781482231137-tables-atoms-and-molecules-gorur-g-raju</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781482231137.jpg?v=1767770707</image:loc>
      <image:title>Dielectrics in Electric Fields</image:title>
      <image:caption>Book cover of: Dielectrics in Electric Fields. By: Gorur G. Raju</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-expert-witnessing-fourth-edition-taylor-francis-ltd-9780367229290-practices-for-the-21st-century-jack-v-matson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367229290.jpg?v=1767770707</image:loc>
      <image:title>Effective Expert Witnessing, Fourth Edition</image:title>
      <image:caption>Book cover of: Effective Expert Witnessing, Fourth Edition. By: Jack V. Matson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diet-for-a-large-planet-the-university-of-chicago-press-9780226697109-industrial-britain-food-systems-and-world-ecology-chris-otter</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226697109.jpg?v=1767770707</image:loc>
      <image:title>Diet for a Large Planet</image:title>
      <image:caption>Book cover of: Diet for a Large Planet. By: Chris Otter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-functional-progressions-in-sport-rehabilitation-human-kinetics-publishers-9780736063814-todd-s-ellenbecker</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780736063814.jpg?v=1767770708</image:loc>
      <image:title>Effective Functional Progressions in Sport Rehabilitation</image:title>
      <image:caption>Book cover of: Effective Functional Progressions in Sport Rehabilitation. By: Todd S. Ellenbecker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dieppe-raid-pen-sword-books-ltd-9781526752918-the-combined-operations-assault-on-hitler-s-european-fortress-august-1942-u-k-war-uk-war-office</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781526752918.jpg?v=1767770708</image:loc>
      <image:title>Dieppe Raid</image:title>
      <image:caption>Book cover of: Dieppe Raid. By: U. K. War UK War Office</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dienstleistungsmarketing-peter-lang-ag-9783631465127-eine-bestandsaufnahme-tagungsband-zum-2-workshop-fuer-dienstleistungsmarketing-innsbruck-februar-1993</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631465127.jpg?v=1767770710</image:loc>
      <image:title>Dienstleistungsmarketing</image:title>
      <image:caption>Book cover of: Dienstleistungsmarketing</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dienstleistungen-in-der-realen-auenwirtschaftstheorie-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631482063</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631482063.jpg?v=1767770708</image:loc>
      <image:title>Dienstleistungen in der Realen Auenwirtschaftstheorie</image:title>
      <image:caption>Book cover of: Dienstleistungen in der Realen Auenwirtschaftstheorie</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-exhibit-interpretation-and-design-altamira-press-9780759121102-tessa-bridal</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780759121102.jpg?v=1767770708</image:loc>
      <image:title>Effective Exhibit Interpretation and Design</image:title>
      <image:caption>Book cover of: Effective Exhibit Interpretation and Design. By: Tessa Bridal</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-health-risk-messages-sage-publications-inc-9780761915089-a-step-by-step-guide-kim-witte</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761915089.jpg?v=1767770708</image:loc>
      <image:title>Effective Health Risk Messages</image:title>
      <image:caption>Book cover of: Effective Health Risk Messages. By: Kim Witte</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-evaluation-of-training-and-development-in-higher-education-taylor-francis-ltd-9781138167308-thackwray-bob-adviser-universities-and-colleges-staff-development-agency-bob-adviser</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138167308.jpg?v=1767770709</image:loc>
      <image:title>Effective Evaluation of Training and Development in Higher Education</image:title>
      <image:caption>Book cover of: Effective Evaluation of Training and Development in Higher Education. By: Thackwray, Bob (Adviser, Universities and Colleges Staff Development Agency), Bob (Adviser</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dies-irae-university-of-westminster-press-9781912656301-jean-luc-nancy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781912656301.jpg?v=1767770708</image:loc>
      <image:title>Dies Irae</image:title>
      <image:caption>Book cover of: Dies Irae. By: Jean-Luc Nancy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-first-person-biblical-preaching-zondervan-9780310263098-the-steps-from-text-to-narrative-sermon-j-kent-edwards</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780310263098.jpg?v=1767770709</image:loc>
      <image:title>Effective First-Person Biblical Preaching</image:title>
      <image:caption>Book cover of: Effective First-Person Biblical Preaching. By: J. Kent Edwards</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dielectric-materials-and-applications-nova-science-publishers-inc-9781536153163-pankaj-kr-choudhury</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781536153163.jpg?v=1767770707</image:loc>
      <image:title>Dielectric Materials and Applications</image:title>
      <image:caption>Book cover of: Dielectric Materials and Applications. By: Pankaj Kr Choudhury</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dienamine-catalysis-for-organic-synthesis-royal-society-of-chemistry-9781782620907-kengadarane-anebouselvy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781782620907.jpg?v=1767770709</image:loc>
      <image:title>Dienamine Catalysis for Organic Synthesis</image:title>
      <image:caption>Book cover of: Dienamine Catalysis for Organic Synthesis. By: Kengadarane Anebouselvy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-financial-planning-for-library-and-information-services-taylor-francis-ltd-9780851424644</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780851424644.jpg?v=1767770707</image:loc>
      <image:title>Effective Financial Planning for Library and Information Services</image:title>
      <image:caption>Book cover of: Effective Financial Planning for Library and Information Services</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-educational-leadership-sage-publications-inc-9780761940562</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761940562.jpg?v=1767770707</image:loc>
      <image:title>Effective Educational Leadership</image:title>
      <image:caption>Book cover of: Effective Educational Leadership</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-environmental-management-in-developing-countries-palgrave-macmillan-9780230542761-assessing-social-capacity-development-shunji-matsuoka</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780230542761.jpg?v=1767770711</image:loc>
      <image:title>Effective Environmental Management in Developing Countries</image:title>
      <image:caption>Book cover of: Effective Environmental Management in Developing Countries. By: Shunji Matsuoka</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-experimentation-john-wiley-sons-inc-9780470684603-for-scientists-and-technologists-richard-boddy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780470684603.jpg?v=1767770708</image:loc>
      <image:title>Effective Experimentation</image:title>
      <image:caption>Book cover of: Effective Experimentation. By: Richard Boddy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diesel-emissions-nova-science-publishers-inc-9781620815618-reduction-efforts-jarrett-f-price</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781620815618.jpg?v=1767770710</image:loc>
      <image:title>Diesel Emissions</image:title>
      <image:caption>Book cover of: Diesel Emissions. By: Jarrett F. Price</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-exhibit-interpretation-and-design-altamira-press-9780759121119</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780759121119.jpg?v=1767770710</image:loc>
      <image:title>Effective Exhibit Interpretation and Design</image:title>
      <image:caption>Book cover of: Effective Exhibit Interpretation and Design</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dielectric-materials-nova-science-publishers-inc-9781607410393-introduction-research-applications-ram-naresh-prasad-choudhary</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781607410393.jpg?v=1767770709</image:loc>
      <image:title>Dielectric Materials</image:title>
      <image:caption>Book cover of: Dielectric Materials. By: Ram Naresh Prasad Choudhary</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diek-grobler-lap-lambert-academic-publishing-9783848415571</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783848415571.jpg?v=1767770709</image:loc>
      <image:title>Diek Grobler</image:title>
      <image:caption>Book cover of: Diek Grobler</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zweite-welt-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631477762-experimente-mit-sprache-spiel-und-illusion-im-modernen-englischsprachigen-drama</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631477762.jpg?v=1767770709</image:loc>
      <image:title>Die zweite Welt</image:title>
      <image:caption>Book cover of: Die zweite Welt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zweitanmelderproblematik-am-beispiel-des-arzneimittelrechts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631451823</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631451823.jpg?v=1767770709</image:loc>
      <image:title>Die Zweitanmelderproblematik am Beispiel des Arzneimittelrechts</image:title>
      <image:caption>Book cover of: Die Zweitanmelderproblematik am Beispiel des Arzneimittelrechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-discipling-in-muslim-communities-scripture-history-and-seasoned-practices-intervarsity-press-9780830824700</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780830824700.jpg?v=1767770710</image:loc>
      <image:title>Effective Discipling in Muslim Communities – Scripture, History and Seasoned Practices</image:title>
      <image:caption>Book cover of: Effective Discipling in Muslim Communities – Scripture, History and Seasoned Practices</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dielectric-materials-for-electrical-engineering-iste-ltd-and-john-wiley-sons-inc-9781848211650</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781848211650.jpg?v=1767770710</image:loc>
      <image:title>Dielectric Materials for Electrical Engineering</image:title>
      <image:caption>Book cover of: Dielectric Materials for Electrical Engineering</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/dienstbotenzeitungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631473610-die-dienstbotenfrage-und-erzaehlungen-fuer-dienstmaedchen-in-deutschen-dienstbotenzeitungen-zwischen-1898-und-1932</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631473610.jpg?v=1767770709</image:loc>
      <image:title>Dienstbotenzeitungen</image:title>
      <image:caption>Book cover of: Dienstbotenzeitungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-educational-leadership-sage-publications-inc-9780761940555</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761940555.jpg?v=1767770710</image:loc>
      <image:title>Effective Educational Leadership</image:title>
      <image:caption>Book cover of: Effective Educational Leadership</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diecast-toy-cars-of-the-1950s-1960s-david-charles-9781787111172-the-collector-s-guide-andrew-ralston</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781787111172.jpg?v=1767770709</image:loc>
      <image:title>Diecast Toy Cars of the 1950s &amp; 1960s</image:title>
      <image:caption>Book cover of: Diecast Toy Cars of the 1950s &amp; 1960s. By: Andrew Ralston</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-early-learning-sage-publications-inc-9780761972938-case-studies-in-improvement-christine-pascal</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761972938.jpg?v=1767770709</image:loc>
      <image:title>Effective Early Learning</image:title>
      <image:caption>Book cover of: Effective Early Learning. By: Christine Pascal</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zusammenschlukontrolle-von-versicherungen-und-kreditinstituten-nach-der-europaeischen-fusionskontrollverordnung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631323090</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631323090.jpg?v=1767770709</image:loc>
      <image:title>Die Zusammenschlukontrolle von Versicherungen und Kreditinstituten nach der Europaeischen Fusionskontrollverordnung</image:title>
      <image:caption>Book cover of: Die Zusammenschlukontrolle von Versicherungen und Kreditinstituten nach der Europaeischen Fusionskontrollverordnung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zweite-talmuddisputation-von-paris-1269-peter-lang-ag-9783631366738-ursula-ragacs</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631366738.jpg?v=1767770710</image:loc>
      <image:title>Die Zweite Talmuddisputation Von Paris 1269</image:title>
      <image:caption>Book cover of: Die Zweite Talmuddisputation Von Paris 1269. By: Ursula Ragacs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-demand-and-income-distribution-taylor-francis-ltd-9780367007027-issues-in-alternative-economic-theory-marc-jarsulic</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367007027.jpg?v=1767770710</image:loc>
      <image:title>Effective Demand And Income Distribution</image:title>
      <image:caption>Book cover of: Effective Demand And Income Distribution. By: Marc Jarsulic</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zusammenarbeit-der-sozialpartner-peter-lang-international-academic-publishers-9783261020123-aufgrund-der-bestehenden-kollektivvertraege-und-aehnlicher-kollektiver-abreden-dargestellt-am-beispiel-der-maschinenindustrie-und-des-metallgewerbes-der-schwei</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261020123.jpg?v=1767770711</image:loc>
      <image:title>Die Zusammenarbeit der Sozialpartner</image:title>
      <image:caption>Book cover of: Die Zusammenarbeit der Sozialpartner. By: Jurgen Kampgen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diego-costa-the-beast-john-blake-publishing-ltd-9781784186500-harry-harris</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781784186500.jpg?v=1767770709</image:loc>
      <image:title>Diego Costa - The Beast</image:title>
      <image:caption>Book cover of: Diego Costa - The Beast. By: Harry Harris</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-evaluation-of-training-and-development-in-higher-education-taylor-francis-ltd-9780749421229-bob-thackwray</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780749421229.jpg?v=1767770711</image:loc>
      <image:title>Effective Evaluation of Training and Development in Higher Education</image:title>
      <image:caption>Book cover of: Effective Evaluation of Training and Development in Higher Education. By: Bob Thackwray</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-discipline-in-the-home-and-school-taylor-francis-ltd-9780915202898</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780915202898.jpg?v=1767770710</image:loc>
      <image:title>Effective Discipline In The Home And School</image:title>
      <image:caption>Book cover of: Effective Discipline In The Home And School</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zusammenarbeit-von-deutschen-mitgliedern-des-europaeischen-parlamentes-und-des-deutschen-bundestages-und-ihr-beitrag-zum-abbau-des-parlamentarischen-defizits-in-der-europaeischen-gemeinschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631432877.jpg?v=1767770709</image:loc>
      <image:title>Die Zusammenarbeit von deutschen Mitgliedern des Europaeischen Parlamentes und des Deutschen Bundestages und ihr Beitrag zum Abbau des parlamentarischen Defizits in der Europaeischen Gemeinschaft</image:title>
      <image:caption>Book cover of: Die Zusammenarbeit von deutschen Mitgliedern des Europaeischen Parlamentes und des Deutschen Bundestages und ihr Beitrag zum Abbau des parlamentarischen Defizits in der Europaeischen Gemeinschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-early-childhood-education-taylor-francis-ltd-9781138993372-cross-cultural-perspectives-lotty-eldering</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138993372.jpg?v=1767770710</image:loc>
      <image:title>Effective Early Childhood Education</image:title>
      <image:caption>Book cover of: Effective Early Childhood Education. By: Lotty Eldering</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diego-rivera-illustrious-words-1886-1921-vol-1-rm-verlag-sl-9788492480104-roberto-pliego</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9788492480104.jpg?v=1767770711</image:loc>
      <image:title>Diego Rivera: Illustrious Words 1886-1921 Vol.1</image:title>
      <image:caption>Book cover of: Diego Rivera: Illustrious Words 1886-1921 Vol.1. By: Roberto Pliego</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zypernfrage-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820410457-problematik-und-perspektiven-eines-dauerkonflikts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820410457.jpg?v=1767770708</image:loc>
      <image:title>Die Zypernfrage</image:title>
      <image:caption>Book cover of: Die Zypernfrage</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-curriculum-management-taylor-francis-ltd-9780415124096-co-ordinating-learning-in-the-primary-school-neil-kitson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415124096.jpg?v=1767770712</image:loc>
      <image:title>Effective Curriculum Management</image:title>
      <image:caption>Book cover of: Effective Curriculum Management. By: Neil Kitson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zusagenpraxis-im-system-der-zusammenschlukontrolle-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631477113</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631477113.jpg?v=1767770713</image:loc>
      <image:title>Die Zusagenpraxis im System der Zusammenschlukontrolle</image:title>
      <image:caption>Book cover of: Die Zusagenpraxis im System der Zusammenschlukontrolle</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zuordnung-verteilungspolitischer-kompetenzen-in-der-europaeischen-gemeinschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631446669-eine-untersuchung-aufgrund-einer-fortentwicklung-der-oekonomischen-theorie-des-foederalismus</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631446669.jpg?v=1767770712</image:loc>
      <image:title>Die Zuordnung verteilungspolitischer Kompetenzen in der Europaeischen Gemeinschaft</image:title>
      <image:caption>Book cover of: Die Zuordnung verteilungspolitischer Kompetenzen in der Europaeischen Gemeinschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zuordnung-von-zinseinnahmen-zu-den-einzelnen-einkuenften-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631308431</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631308431.jpg?v=1767770712</image:loc>
      <image:title>Die Zuordnung von Zinseinnahmen zu den einzelnen Einkuenften</image:title>
      <image:caption>Book cover of: Die Zuordnung von Zinseinnahmen zu den einzelnen Einkuenften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-decision-making-rev-ed-pan-macmillan-9780330504225-the-essential-guide-to-thinking-for-management-success-john-eric-adair</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780330504225.jpg?v=1767770710</image:loc>
      <image:title>Effective Decision Making (REV ED)</image:title>
      <image:caption>Book cover of: Effective Decision Making (REV ED). By: John Eric Adair</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zyklisierung-lyrischer-texte-bei-aleksandr-a-blok-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876904108</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876904108.jpg?v=1767770709</image:loc>
      <image:title>Die Zyklisierung lyrischer Texte bei Aleksandr A. Blok</image:title>
      <image:caption>Book cover of: Die Zyklisierung lyrischer Texte bei Aleksandr A. Blok</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/diesel-internal-combustion-engines-nova-science-publishers-inc-9781536121254-overview-performance-applications-horace-g-norton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781536121254.jpg?v=1767770709</image:loc>
      <image:title>Diesel &amp; Internal Combustion Engines</image:title>
      <image:caption>Book cover of: Diesel &amp; Internal Combustion Engines. By: Horace G. Norton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-crm-using-predictive-analytics-john-wiley-sons-inc-9781119011552-antonios-chorianopoulos</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781119011552.jpg?v=1767770713</image:loc>
      <image:title>Effective CRM using Predictive Analytics</image:title>
      <image:caption>Book cover of: Effective CRM using Predictive Analytics. By: Antonios Chorianopoulos</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-counselling-with-young-people-sage-publications-ltd-9780857252951-hazel-l-reid</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780857252951.jpg?v=1767770712</image:loc>
      <image:title>Effective Counselling with Young People</image:title>
      <image:caption>Book cover of: Effective Counselling with Young People. By: Hazel L. Reid</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zweitanmelderproblematik-im-pflanzenschutzrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631467565-rechtsvergleich-zwischen-den-regelungen-der-eg-richtlinie-ueber-das-inverkehrbringen-von-pflanzenschutzmitteln-und-des-deutschen-pf</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631467565.jpg?v=1767770709</image:loc>
      <image:title>Die Zweitanmelderproblematik im Pflanzenschutzrecht</image:title>
      <image:caption>Book cover of: Die Zweitanmelderproblematik im Pflanzenschutzrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zustaendigkeit-des-gesamtbetriebsrates-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631355091-burkhard-siebert</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631355091.jpg?v=1767770710</image:loc>
      <image:title>Die Zustaendigkeit des Gesamtbetriebsrates</image:title>
      <image:caption>Book cover of: Die Zustaendigkeit des Gesamtbetriebsrates. By: Burkhard Siebert</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zwischenbetriebliche-kooperation-peter-lang-ag-9783631465905-ein-weg-zur-internationalisierung-von-klein-und-mittelbetrieben</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631465905.jpg?v=1767770708</image:loc>
      <image:title>Die Zwischenbetriebliche Kooperation</image:title>
      <image:caption>Book cover of: Die Zwischenbetriebliche Kooperation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-curriculum-for-teaching-l2-writing-taylor-francis-ltd-9780415889988-principles-and-techniques-eli-hinkel</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415889988.jpg?v=1767770710</image:loc>
      <image:title>Effective Curriculum for Teaching L2 Writing</image:title>
      <image:caption>Book cover of: Effective Curriculum for Teaching L2 Writing. By: Eli Hinkel</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-counseling-and-psychotherapy-springer-publishing-co-inc-9780826141125-an-evidence-based-approach-bob-bertolino-phd</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780826141125.jpg?v=1767770712</image:loc>
      <image:title>Effective Counseling and Psychotherapy</image:title>
      <image:caption>Book cover of: Effective Counseling and Psychotherapy. By: Bob Bertolino PhD</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zweifelhafte-schuldfaehigkeit-peter-lang-ag-9783631498255-einfuehrung-in-theorie-und-praxis-der-begutachtung-fuer-beteiligte-an-gerichtsverfahren</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631498255.jpg?v=1767770710</image:loc>
      <image:title>Die Zweifelhafte Schuldfaehigkeit</image:title>
      <image:caption>Book cover of: Die Zweifelhafte Schuldfaehigkeit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zuordnung-der-altenglischen-substantive-zu-den-flexionstypen-untersucht-am-buchstaben-d-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631441640</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631441640.jpg?v=1767770713</image:loc>
      <image:title>Die Zuordnung der altenglischen Substantive zu den Flexionstypen untersucht am Buchstaben D</image:title>
      <image:caption>Book cover of: Die Zuordnung der altenglischen Substantive zu den Flexionstypen untersucht am Buchstaben D</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-early-childhood-education-taylor-francis-inc-9780815324447-cross-cultural-perspectives</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815324447.jpg?v=1767770713</image:loc>
      <image:title>Effective Early Childhood Education</image:title>
      <image:caption>Book cover of: Effective Early Childhood Education</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-conservation-science-oxford-university-press-9780198808985-data-not-dogma-peter-kareiva</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780198808985.jpg?v=1767770711</image:loc>
      <image:title>Effective Conservation Science</image:title>
      <image:caption>Book cover of: Effective Conservation Science. By: Peter Kareiva</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zwischenbetriebliche-zusammenarbeit-in-der-landwirtschaft-der-sowjetrepublik-litauen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820489194</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820489194.jpg?v=1767770713</image:loc>
      <image:title>Die zwischenbetriebliche Zusammenarbeit in der Landwirtschaft der Sowjetrepublik Litauen</image:title>
      <image:caption>Book cover of: Die zwischenbetriebliche Zusammenarbeit in der Landwirtschaft der Sowjetrepublik Litauen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zurechnung-von-folgeschaeden-im-strafrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631459188</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631459188.jpg?v=1767770710</image:loc>
      <image:title>Die Zurechnung von Folgeschaeden im Strafrecht</image:title>
      <image:caption>Book cover of: Die Zurechnung von Folgeschaeden im Strafrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-communication-for-arts-and-humanities-students-bloomsbury-publishing-plc-9780333984871</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780333984871.jpg?v=1767770710</image:loc>
      <image:title>Effective Communication for Arts and Humanities Students</image:title>
      <image:caption>Book cover of: Effective Communication for Arts and Humanities Students</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-curriculum-for-teaching-l2-writing-taylor-francis-ltd-9780415889995-principles-and-techniques</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415889995.jpg?v=1767770711</image:loc>
      <image:title>Effective Curriculum for Teaching L2 Writing</image:title>
      <image:caption>Book cover of: Effective Curriculum for Teaching L2 Writing</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zunge-peter-lang-international-academic-publishers-9783261016805-ihre-funktion-und-die-bedeutung-in-sprachheilpaedagogischer-hinsicht-cilli-schwarz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261016805.jpg?v=1767770709</image:loc>
      <image:title>Die Zunge</image:title>
      <image:caption>Book cover of: Die Zunge. By: Cilli Schwarz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-committee-service-sage-publications-inc-9780803948198</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780803948198.jpg?v=1767770713</image:loc>
      <image:title>Effective Committee Service</image:title>
      <image:caption>Book cover of: Effective Committee Service</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zurechnung-bei-der-beihilfe-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631313923-zugleich-eine-untersuchung-zur-strafbarkeit-von-rechtsanwaelten-nach-27-stgb</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631313923.jpg?v=1767770711</image:loc>
      <image:title>Die Zurechnung bei der Beihilfe</image:title>
      <image:caption>Book cover of: Die Zurechnung bei der Beihilfe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-cybersecurity-pearson-education-us-9780134772806-a-guide-to-using-best-practices-and-standards-stallings-william</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780134772806.jpg?v=1767770710</image:loc>
      <image:title>Effective Cybersecurity</image:title>
      <image:caption>Book cover of: Effective Cybersecurity. By: STALLINGS, WILLIAM</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zulaessigkeit-von-wirtschaftssanktionen-der-europaeischen-gemeinschaft-gegenueber-drittstaaten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820481273</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820481273.jpg?v=1767770711</image:loc>
      <image:title>Die Zulaessigkeit von Wirtschaftssanktionen der europaeischen Gemeinschaft gegenueber Drittstaaten</image:title>
      <image:caption>Book cover of: Die Zulaessigkeit von Wirtschaftssanktionen der europaeischen Gemeinschaft gegenueber Drittstaaten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-communications-taylor-francis-ltd-9780080465296-elearn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780080465296.jpg?v=1767770713</image:loc>
      <image:title>Effective Communications</image:title>
      <image:caption>Book cover of: Effective Communications. By: Elearn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zulaessigkeit-materieller-beweiserleichterungen-im-strafrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631368039-eine-untersuchung-ueber-erscheinungsformen-und-grenzen-der-loesung-beweisrechtlicher-probleme-im-materiellen-strafrec</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631368039.jpg?v=1767770711</image:loc>
      <image:title>Die Zulaessigkeit materieller Beweiserleichterungen im Strafrecht</image:title>
      <image:caption>Book cover of: Die Zulaessigkeit materieller Beweiserleichterungen im Strafrecht. By: Kristian Hohn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zurechnung-von-buchgutschriften-peter-lang-ag-9783631519370-zuflu-und-leistungsfaehigkeit-im-einkommensteuerrecht-eva-ullrich</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631519370.jpg?v=1767770712</image:loc>
      <image:title>Die Zurechnung Von Buchgutschriften</image:title>
      <image:caption>Book cover of: Die Zurechnung Von Buchgutschriften. By: Eva Ullrich</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-communication-with-people-who-have-hearing-difficulties-taylor-francis-ltd-9780863883415-group-training-sessions</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780863883415.jpg?v=1767770713</image:loc>
      <image:title>Effective Communication with People Who Have Hearing Difficulties</image:title>
      <image:caption>Book cover of: Effective Communication with People Who Have Hearing Difficulties</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-collaboration-palgrave-macmillan-9780333948101-managing-the-obstacles-to-success</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780333948101.jpg?v=1767770712</image:loc>
      <image:title>Effective Collaboration</image:title>
      <image:caption>Book cover of: Effective Collaboration</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zulaessigkeit-neuer-arbeitskampfformen-peter-lang-international-academic-publishers-9783261019240</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261019240.jpg?v=1767770711</image:loc>
      <image:title>Die Zulaessigkeit neuer Arbeitskampfformen</image:title>
      <image:caption>Book cover of: Die Zulaessigkeit neuer Arbeitskampfformen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-clinical-practice-in-the-treatment-of-eating-disorders-taylor-francis-ltd-9780415964616-the-heart-of-the-matter</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415964616.jpg?v=1767770711</image:loc>
      <image:title>Effective Clinical Practice in the Treatment of Eating Disorders</image:title>
      <image:caption>Book cover of: Effective Clinical Practice in the Treatment of Eating Disorders</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-c-pearson-education-us-9780321334879-55-specific-ways-to-improve-your-programs-and-designs-scott-meyers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780321334879.jpg?v=1767770712</image:loc>
      <image:title>Effective C++</image:title>
      <image:caption>Book cover of: Effective C++. By: SCOTT MEYERS</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zulassung-von-zahnaerzten-aus-dem-eg-bereich-zur-deutschen-kassenarztpraxis-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631406915-ein-beitrag-zu-standort-und-bedeutung-der-grundrechte-im-europaeischen-gemeinschaftsrecht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631406915.jpg?v=1767770712</image:loc>
      <image:title>Die Zulassung von Zahnaerzten aus dem EG-Bereich zur deutschen Kassenarztpraxis</image:title>
      <image:caption>Book cover of: Die Zulassung von Zahnaerzten aus dem EG-Bereich zur deutschen Kassenarztpraxis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-clinical-practice-in-the-treatment-of-eating-disorders-taylor-francis-ltd-9781138881716-the-heart-of-the-matter-margo-maine</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138881716.jpg?v=1767770711</image:loc>
      <image:title>Effective Clinical Practice in the Treatment of Eating Disorders</image:title>
      <image:caption>Book cover of: Effective Clinical Practice in the Treatment of Eating Disorders. By: Margo Maine</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-classroom-management-taylor-francis-ltd-9780415071529-a-teacher-s-guide-robert-laslett</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415071529.jpg?v=1767770711</image:loc>
      <image:title>Effective Classroom Management</image:title>
      <image:caption>Book cover of: Effective Classroom Management. By: Robert Laslett</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-classroom-management-teachers-college-press-9780807755747-the-essentials-tracey-garrett</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780807755747.jpg?v=1767770714</image:loc>
      <image:title>Effective Classroom Management</image:title>
      <image:caption>Book cover of: Effective Classroom Management. By: Tracey Garrett</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-advertising-sage-publications-inc-9780761922537-understanding-when-how-and-why-advertising-works-gerard-j-tellis</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761922537.jpg?v=1767770713</image:loc>
      <image:title>Effective Advertising</image:title>
      <image:caption>Book cover of: Effective Advertising. By: Gerard J. Tellis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zulaessigkeit-von-verfassungsbeschwerden-gegen-gerichtliche-eilentscheidungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631459263</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631459263.jpg?v=1767770712</image:loc>
      <image:title>Die Zulaessigkeit von Verfassungsbeschwerden gegen gerichtliche Eilentscheidungen</image:title>
      <image:caption>Book cover of: Die Zulaessigkeit von Verfassungsbeschwerden gegen gerichtliche Eilentscheidungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zulaessigkeit-der-mehrfachbeteiligung-an-einer-personengesellschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631325056</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631325056.jpg?v=1767770711</image:loc>
      <image:title>Die Zulaessigkeit der Mehrfachbeteiligung an einer Personengesellschaft</image:title>
      <image:caption>Book cover of: Die Zulaessigkeit der Mehrfachbeteiligung an einer Personengesellschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zulaessigkeit-der-enteignung-zugunsten-privater-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631500477</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631500477.jpg?v=1767770710</image:loc>
      <image:title>Die Zulaessigkeit der Enteignung zugunsten Privater</image:title>
      <image:caption>Book cover of: Die Zulaessigkeit der Enteignung zugunsten Privater</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-coaching-in-strength-and-conditioning-taylor-francis-ltd-9780415839983-pathways-to-superior-performance-ian-jeffreys</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415839983.jpg?v=1767770713</image:loc>
      <image:title>Effective Coaching in Strength and Conditioning</image:title>
      <image:caption>Book cover of: Effective Coaching in Strength and Conditioning. By: Ian Jeffreys</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-bible-teaching-baker-publishing-group-9780801048609-jim-wilhoit</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780801048609.jpg?v=1767770713</image:loc>
      <image:title>Effective Bible Teaching</image:title>
      <image:caption>Book cover of: Effective Bible Teaching. By: Jim Wilhoit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-coaching-in-strength-and-conditioning-taylor-francis-ltd-9780415839990-pathways-to-superior-performance-ian-jeffreys</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415839990.jpg?v=1767770714</image:loc>
      <image:title>Effective Coaching in Strength and Conditioning</image:title>
      <image:caption>Book cover of: Effective Coaching in Strength and Conditioning. By: Ian Jeffreys</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-advertising-sage-publications-inc-9780761922520-understanding-when-how-and-why-advertising-works-gerard-j-tellis</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761922520.jpg?v=1767770712</image:loc>
      <image:title>Effective Advertising</image:title>
      <image:caption>Book cover of: Effective Advertising. By: Gerard J. Tellis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zivilrechtliche-verantwortlichkeit-fuer-die-rechnungslegung-von-gmbh-und-gmbh-co-kg-nach-dem-bilanzrichtlinie-gesetz-und-die-moeglichkeit-ihrer-versicherung-in-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820494266</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820494266.jpg?v=1767770712</image:loc>
      <image:title>Die zivilrechtliche Verantwortlichkeit fuer die Rechnungslegung von GmbH und GmbH &amp; Co KG nach dem Bilanzrichtlinie-Gesetz und die Moeglichkeit ihrer Versicherung in Deutschland</image:title>
      <image:caption>Book cover of: Die zivilrechtliche Verantwortlichkeit fuer die Rechnungslegung von GmbH und GmbH &amp; Co KG nach dem Bilanzrichtlinie-Gesetz und die Moeglichkeit ihrer Versicherung in Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-change-in-schools-taylor-francis-ltd-9780415221900-una-connolly</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415221900.jpg?v=1767770714</image:loc>
      <image:title>Effective Change in Schools</image:title>
      <image:caption>Book cover of: Effective Change in Schools. By: Una Connolly</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zukunft-der-schulen-der-vierzehn-bis-neunzehnjaehrigen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631309063-elizabeth-persy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631309063.jpg?v=1767770713</image:loc>
      <image:title>Die Zukunft der Schulen der Vierzehn- bis Neunzehnjaehrigen</image:title>
      <image:caption>Book cover of: Die Zukunft der Schulen der Vierzehn- bis Neunzehnjaehrigen. By: Elizabeth Persy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zulaessigkeit-der-drittwiderklage-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631487488-eine-untersuchung-ueber-die-zulaessigkeit-das-beduerfnis-und-die-grenzen-einer-widerklageerhebung-durch-und-gegen-dritte</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631487488.jpg?v=1767770711</image:loc>
      <image:title>Die Zulaessigkeit der Drittwiderklage</image:title>
      <image:caption>Book cover of: Die Zulaessigkeit der Drittwiderklage</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zulaessigkeit-einstweiliger-verfuegungen-gegen-betriebsaenderungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631329139</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631329139.jpg?v=1767770714</image:loc>
      <image:title>Die Zulaessigkeit einstweiliger Verfuegungen gegen Betriebsaenderungen</image:title>
      <image:caption>Book cover of: Die Zulaessigkeit einstweiliger Verfuegungen gegen Betriebsaenderungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-approaches-for-managing-electronic-records-and-archives-scarecrow-press-9780810857421-bruce-w-dearstyne</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780810857421.jpg?v=1767770714</image:loc>
      <image:title>Effective Approaches for Managing Electronic Records and Archives</image:title>
      <image:caption>Book cover of: Effective Approaches for Managing Electronic Records and Archives. By: Bruce W. Dearstyne</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zukunft-der-informations-und-kommunikationstechnologie-in-privaten-haushalten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631368404-eine-delphi-studie</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631368404.jpg?v=1767770711</image:loc>
      <image:title>Die Zukunft der Informations- und Kommunikationstechnologie in privaten Haushalten</image:title>
      <image:caption>Book cover of: Die Zukunft der Informations- und Kommunikationstechnologie in privaten Haushalten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-behaviour-management-in-the-primary-classroom-open-university-press-9780335225415-fiona-shelton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780335225415.jpg?v=1767770712</image:loc>
      <image:title>Effective Behaviour Management in the Primary Classroom</image:title>
      <image:caption>Book cover of: Effective Behaviour Management in the Primary Classroom. By: Fiona Shelton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zukunft-der-pflegesicherung-in-suedkorea-peter-lang-ag-9783631521441-moeglichkeiten-und-grenzen-des-transfers-europaeischer-wohlfahrtssysteme-hyun-joo-nam</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631521441.jpg?v=1767770714</image:loc>
      <image:title>Die Zukunft Der Pflegesicherung in Suedkorea</image:title>
      <image:caption>Book cover of: Die Zukunft Der Pflegesicherung in Suedkorea. By: Hyun-Joo Nam</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zivilrechtlichen-schadenersatzansprueche-von-amateur-und-berufssportlern-fuer-verletzungen-beim-fussballspiel-peter-lang-international-academic-publishers-9783261048806-aktuelle-fragen-des-sportrechts-als-anwendungsfaelle-moderner-grundsaetze-des-haft</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261048806.jpg?v=1767770714</image:loc>
      <image:title>Die zivilrechtlichen Schadenersatzansprueche von Amateur- und Berufssportlern fuer Verletzungen beim Fussballspiel</image:title>
      <image:caption>Book cover of: Die zivilrechtlichen Schadenersatzansprueche von Amateur- und Berufssportlern fuer Verletzungen beim Fussballspiel</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zivilrechtliche-und-steuerliche-vorteilhaftigkeit-der-kapitalgesellschaft-co-kg-fuer-direktinvestitionen-in-deutschland-den-niederlanden-england-und-den-usa-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631331101</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631331101.jpg?v=1767770712</image:loc>
      <image:title>Die zivilrechtliche und steuerliche Vorteilhaftigkeit der «Kapitalgesellschaft &amp; Co. KG» fuer Direktinvestitionen in Deutschland, den Niederlanden, England und den USA</image:title>
      <image:caption>Book cover of: Die zivilrechtliche und steuerliche Vorteilhaftigkeit der «Kapitalgesellschaft &amp; Co. KG» fuer Direktinvestitionen in Deutschland, den Niederlanden, England und den USA</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zivilrechtlichen-folgen-der-entgeltlichen-tragemutterschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631417614</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631417614.jpg?v=1767770713</image:loc>
      <image:title>Die zivilrechtlichen Folgen der entgeltlichen Tragemutterschaft</image:title>
      <image:caption>Book cover of: Die zivilrechtlichen Folgen der entgeltlichen Tragemutterschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zivilrechtliche-haftung-fuer-raucherschaeden-peter-lang-ag-9783631538890</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631538890.jpg?v=1767770713</image:loc>
      <image:title>Die Zivilrechtliche Haftung Fuer Raucherschaeden</image:title>
      <image:caption>Book cover of: Die Zivilrechtliche Haftung Fuer Raucherschaeden</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zumutbarkeit-als-rechtsgedanke-im-arbeitsrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631353363-viktoria-bornhagen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631353363.jpg?v=1767770712</image:loc>
      <image:title>Die Zumutbarkeit als Rechtsgedanke im Arbeitsrecht</image:title>
      <image:caption>Book cover of: Die Zumutbarkeit als Rechtsgedanke im Arbeitsrecht. By: Viktoria Bornhagen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effecting-a-quality-change-taylor-francis-ltd-9780415503228-s-w-field</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415503228.jpg?v=1767770713</image:loc>
      <image:title>Effecting a Quality Change</image:title>
      <image:caption>Book cover of: Effecting a Quality Change. By: S. W. Field</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zwangsvollstreckung-in-das-guthaben-des-notaranderkontos-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631494622</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631494622.jpg?v=1767770713</image:loc>
      <image:title>Die Zwangsvollstreckung in das Guthaben des Notaranderkontos</image:title>
      <image:caption>Book cover of: Die Zwangsvollstreckung in das Guthaben des Notaranderkontos</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-and-safe-waste-management-taylor-francis-inc-9780873712415-interfacing-sciences-and-engineering-with-monitoring-and-risk-analysis-robert-l-jolley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780873712415.jpg?v=1767770715</image:loc>
      <image:title>Effective and Safe Waste Management</image:title>
      <image:caption>Book cover of: Effective and Safe Waste Management. By: Robert L. Jolley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-of-riparian-zones-on-nitrate-removal-by-denitrification-at-the-river-basin-scale-taylor-francis-ltd-9781138024052-linh-hoang</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138024052.jpg?v=1767770714</image:loc>
      <image:title>Effect of Riparian Zones on Nitrate Removal by Denitrification at the River Basin Scale</image:title>
      <image:caption>Book cover of: Effect of Riparian Zones on Nitrate Removal by Denitrification at the River Basin Scale. By: Linh Hoang</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zulaessigkeit-aufgedraengter-fuersorge-gegenueber-dem-beschuldigten-im-strafproze-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631421628</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631421628.jpg?v=1767770715</image:loc>
      <image:title>Die Zulaessigkeit aufgedraengter Fuersorge gegenueber dem Beschuldigten im Strafproze</image:title>
      <image:caption>Book cover of: Die Zulaessigkeit aufgedraengter Fuersorge gegenueber dem Beschuldigten im Strafproze</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zivilschutzorganisation-in-der-schweiz-peter-lang-international-academic-publishers-9783261000873-hans-engler</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261000873.jpg?v=1767770716</image:loc>
      <image:title>Die Zivilschutzorganisation in der Schweiz</image:title>
      <image:caption>Book cover of: Die Zivilschutzorganisation in der Schweiz. By: Hans Engler</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zivilrechtliche-haftungsbestimmung-der-gewaesserschutzgesetzgebung-peter-lang-international-academic-publishers-9783261043825-abhandlung-und-rechtfertigung-einer-verschuldensunabhaengigen-anspruchsgrundlage</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261043825.jpg?v=1767770713</image:loc>
      <image:title>Die zivilrechtliche Haftungsbestimmung der Gewaesserschutzgesetzgebung</image:title>
      <image:caption>Book cover of: Die zivilrechtliche Haftungsbestimmung der Gewaesserschutzgesetzgebung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zivilrechtliche-haftung-bei-vertragsverhandlungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631367766-eine-rechtsvergleichende-studie-zum-deutschen-franzoesischen-aegyptischen-und-islamischen-recht-almontasser-fetih</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631367766.jpg?v=1767770713</image:loc>
      <image:title>Die zivilrechtliche Haftung bei Vertragsverhandlungen</image:title>
      <image:caption>Book cover of: Die zivilrechtliche Haftung bei Vertragsverhandlungen. By: Almontasser Fetih</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zeitliche-unbestimmtheit-freiheitsentziehender-sanktionen-des-strafrechts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631406298-eine-vergleichende-untersuchung-zur-rechtslage-und-strafvollstreckungspraxis-in-der-bundesrepublik-deutsc</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631406298.jpg?v=1767770713</image:loc>
      <image:title>Die zeitliche Unbestimmtheit freiheitsentziehender Sanktionen des Strafrechts</image:title>
      <image:caption>Book cover of: Die zeitliche Unbestimmtheit freiheitsentziehender Sanktionen des Strafrechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zivilrechtliche-beurteilung-der-humanforschung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820472493</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820472493.jpg?v=1767770715</image:loc>
      <image:title>Die zivilrechtliche Beurteilung der Humanforschung</image:title>
      <image:caption>Book cover of: Die zivilrechtliche Beurteilung der Humanforschung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-size-for-anova-designs-sage-publications-inc-9780761915508-jose-m-cortina</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761915508.jpg?v=1767770713</image:loc>
      <image:title>Effect Size for ANOVA Designs</image:title>
      <image:caption>Book cover of: Effect Size for ANOVA Designs. By: Jose M. Cortina</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-action-in-quantum-gravity-taylor-francis-ltd-9780750301220-i-l-buchbinder</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750301220.jpg?v=1767770714</image:loc>
      <image:title>Effective Action in Quantum Gravity</image:title>
      <image:caption>Book cover of: Effective Action in Quantum Gravity. By: I.L Buchbinder</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zeitstruktur-der-produktion-als-ursache-oekonomischer-dynamik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631405222</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631405222.jpg?v=1767770714</image:loc>
      <image:title>Die Zeitstruktur der Produktion als Ursache oekonomischer Dynamik</image:title>
      <image:caption>Book cover of: Die Zeitstruktur der Produktion als Ursache oekonomischer Dynamik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-of-operational-variables-on-nitrogen-transformations-in-duckweed-stabilization-ponds-taylor-francis-ltd-9780415375542-julia-rosa-caicedo-bejarano</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415375542.jpg?v=1767770713</image:loc>
      <image:title>Effect of Operational Variables on Nitrogen Transformations in Duckweed Stabilization Ponds</image:title>
      <image:caption>Book cover of: Effect of Operational Variables on Nitrogen Transformations in Duckweed Stabilization Ponds. By: Julia Rosa Caicedo Bejarano</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zeitliche-begrenzung-des-urheberrechts-peter-lang-ag-9783631501054</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631501054.jpg?v=1767770712</image:loc>
      <image:title>Die Zeitliche Begrenzung Des Urheberrechts</image:title>
      <image:caption>Book cover of: Die Zeitliche Begrenzung Des Urheberrechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zivilisatorische-staatengesellschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631305232-zivilisation-und-internationale-politik-im-nahen-osten-mit-einem-vorwort-von-bassam-tibi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631305232.jpg?v=1767770713</image:loc>
      <image:title>Die zivilisatorische Staatengesellschaft</image:title>
      <image:caption>Book cover of: Die zivilisatorische Staatengesellschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-of-mineral-organic-microorganism-interactions-on-soil-and-freshwater-environments-springer-science-business-media-9780306462160</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780306462160.jpg?v=1767770715</image:loc>
      <image:title>Effect of Mineral-Organic-Microorganism Interactions on Soil and Freshwater Environments</image:title>
      <image:caption>Book cover of: Effect of Mineral-Organic-Microorganism Interactions on Soil and Freshwater Environments</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zerknirschung-des-herzens-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631420508-untersuchungen-zum-empfindsamen-theater-baculard-d-arnauds</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631420508.jpg?v=1767770713</image:loc>
      <image:title>Die Zerknirschung des Herzens</image:title>
      <image:caption>Book cover of: Die Zerknirschung des Herzens</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-academic-taylor-francis-ltd-9781138178137-a-handbook-for-enhanced-academic-practice-heather-fry</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138178137.jpg?v=1767770714</image:loc>
      <image:title>Effective Academic</image:title>
      <image:caption>Book cover of: Effective Academic. By: Heather Fry</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zigeuner-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631301265-ihr-leben-und-ihre-seele-dargestellt-auf-grund-eigener-reisen-und-forschungen-martin-friedrich-block</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631301265.jpg?v=1767770777</image:loc>
      <image:title>Die Zigeuner</image:title>
      <image:caption>Book cover of: Die Zigeuner. By: Martin Friedrich Block</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zeitgenoessische-literarische-reaktion-auf-den-tod-des-koenigs-gustav-ii-adolf-von-schweden-peter-lang-ag-9783631330265</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631330265.jpg?v=1767770713</image:loc>
      <image:title>Die Zeitgenoessische Literarische Reaktion Auf Den Tod Des Koenigs Gustav II. Adolf Von Schweden</image:title>
      <image:caption>Book cover of: Die Zeitgenoessische Literarische Reaktion Auf Den Tod Des Koenigs Gustav II. Adolf Von Schweden</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-of-children-on-parents-taylor-francis-inc-9780789008558-anne-marie-ambert</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789008558.jpg?v=1767770715</image:loc>
      <image:title>Effect of Children on Parents</image:title>
      <image:caption>Book cover of: Effect of Children on Parents. By: Anne-Marie Ambert</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zauberflote-the-magic-flute-alma-books-ltd-9781847498052-wolfgang-amadeus-mozart</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781847498052.jpg?v=1767770713</image:loc>
      <image:title>Die Zauberflote (The Magic Flute)</image:title>
      <image:caption>Book cover of: Die Zauberflote (The Magic Flute). By: Wolfgang Amadeus Mozart</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-classroom-teamwork-taylor-francis-ltd-9780415080484-support-or-intrusion</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415080484.jpg?v=1767770714</image:loc>
      <image:title>Effective Classroom Teamwork</image:title>
      <image:caption>Book cover of: Effective Classroom Teamwork</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zukunft-der-oeffentlichen-bildung-l-avenir-de-l-education-publique-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906751191</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906751191.jpg?v=1767770715</image:loc>
      <image:title>Die Zukunft der oeffentlichen Bildung - L&apos;avenir de l&apos;education publique</image:title>
      <image:caption>Book cover of: Die Zukunft der oeffentlichen Bildung - L&apos;avenir de l&apos;education publique</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zivilprozessuale-stellung-des-aufsichtsratsmitglieds-der-aktiengesellschaft-bei-innergesellschaftlichen-streitigkeiten-peter-lang-ag-9783631502549-gerd-hans-schock</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631502549.jpg?v=1767770714</image:loc>
      <image:title>Die Zivilprozessuale Stellung Des Aufsichtsratsmitglieds Der Aktiengesellschaft Bei Innergesellschaftlichen Streitigkeiten</image:title>
      <image:caption>Book cover of: Die Zivilprozessuale Stellung Des Aufsichtsratsmitglieds Der Aktiengesellschaft Bei Innergesellschaftlichen Streitigkeiten. By: Gerd-Hans Schock</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zehn-zukunftsthemen-des-controllings-wiley-vch-verlag-gmbh-9783527506927-innovationen-trends-und-herausforderungen-j-rgen-weber</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783527506927.jpg?v=1767770716</image:loc>
      <image:title>Die zehn Zukunftsthemen des Controllings</image:title>
      <image:caption>Book cover of: Die zehn Zukunftsthemen des Controllings. By: Jürgen Weber</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zeitstuecke-von-eleonore-kalkowska-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783899751727-agnes-trapp</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783899751727.jpg?v=1767770715</image:loc>
      <image:title>Die Zeitstuecke Von Eleonore Kalkowska</image:title>
      <image:caption>Book cover of: Die Zeitstuecke Von Eleonore Kalkowska. By: Agnes Trapp</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-of-the-war-on-the-external-trade-of-the-united-kingdom-cambridge-university-press-9781107433205-an-analysis-of-the-monthly-statistics-1906-1914-arthur-lyon-bowley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781107433205.jpg?v=1767770717</image:loc>
      <image:title>Effect of the War on the External Trade of the United Kingdom</image:title>
      <image:caption>Book cover of: Effect of the War on the External Trade of the United Kingdom. By: Arthur Lyon Bowley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-sizes-for-research-taylor-francis-ltd-9780415877688-univariate-and-multivariate-applications-second-edition-robert-j-grissom</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415877688.jpg?v=1767770715</image:loc>
      <image:title>Effect Sizes for Research</image:title>
      <image:caption>Book cover of: Effect Sizes for Research. By: Robert J. Grissom</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-worttrennung-am-zeilenende-in-altenglischen-handschriften-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820458848</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820458848.jpg?v=1767770715</image:loc>
      <image:title>Die Worttrennung am Zeilenende in altenglischen Handschriften</image:title>
      <image:caption>Book cover of: Die Worttrennung am Zeilenende in altenglischen Handschriften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zeitgenoessischen-literaturen-suedosteuropas-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631740217</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631740217.jpg?v=1767770715</image:loc>
      <image:title>Die zeitgenoessischen Literaturen Suedosteuropas</image:title>
      <image:caption>Book cover of: Die zeitgenoessischen Literaturen Suedosteuropas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-change-in-schools-taylor-francis-ltd-9780415221917-una-connolly</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415221917.jpg?v=1767770715</image:loc>
      <image:title>Effective Change in Schools</image:title>
      <image:caption>Book cover of: Effective Change in Schools. By: Una Connolly</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-of-childhood-emotional-maltreatment-on-later-intimate-relationships-taylor-francis-ltd-9780415851077-nancy-dodge-reyome</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415851077.jpg?v=1767770714</image:loc>
      <image:title>Effect of Childhood Emotional Maltreatment on Later Intimate Relationships</image:title>
      <image:caption>Book cover of: Effect of Childhood Emotional Maltreatment on Later Intimate Relationships. By: Nancy Dodge Reyome</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-of-children-on-parents-taylor-francis-inc-9780789008541-anne-marie-ambert</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789008541.jpg?v=1767770717</image:loc>
      <image:title>Effect of Children on Parents</image:title>
      <image:caption>Book cover of: Effect of Children on Parents. By: Anne-Marie Ambert</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wortstellung-in-notkers-consolatio-de-gruyter-9783110080582-untersuchungen-zur-syntax-und-ubersetzungstechnik</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783110080582.jpg?v=1767770716</image:loc>
      <image:title>Die Wortstellung in Notkers Consolatio</image:title>
      <image:caption>Book cover of: Die Wortstellung in Notkers Consolatio</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eerie-america-schiffer-publishing-ltd-9780764344695-travel-guide-of-the-macabre-eric-r-vernor</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780764344695.jpg?v=1767770715</image:loc>
      <image:title>Eerie America</image:title>
      <image:caption>Book cover of: Eerie America. By: Eric R. Vernor</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wurde-des-menschen-neukirchener-verlagsgesellschaft-mbh-9783788718008-paul-d-hanson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783788718008.jpg?v=1767770714</image:loc>
      <image:title>Die Wurde des Menschen</image:title>
      <image:caption>Book cover of: Die Wurde des Menschen. By: Paul D. Hanson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zeitliche-beschraenkung-des-versicherungsschutzes-in-der-rechtsschutzversicherung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631474037</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631474037.jpg?v=1767770716</image:loc>
      <image:title>Die zeitliche Beschraenkung des Versicherungsschutzes in der Rechtsschutzversicherung</image:title>
      <image:caption>Book cover of: Die zeitliche Beschraenkung des Versicherungsschutzes in der Rechtsschutzversicherung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-sizes-for-research-taylor-francis-ltd-9780415877695-univariate-and-multivariate-applications-second-edition-robert-j-grissom</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415877695.jpg?v=1767770716</image:loc>
      <image:title>Effect Sizes for Research</image:title>
      <image:caption>Book cover of: Effect Sizes for Research. By: Robert J. Grissom</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zahl-der-aktiven-schweidruesen-psi-palmar-sweat-index-als-aktivierungsparameter-in-labor-und-feldstudien-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631455210-untersuchungen-mit-der-plastic-finger-print-methode</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631455210.jpg?v=1767770715</image:loc>
      <image:title>Die Zahl der aktiven Schweidruesen (PSI, palmar sweat index) als Aktivierungsparameter in Labor- und Feldstudien</image:title>
      <image:caption>Book cover of: Die Zahl der aktiven Schweidruesen (PSI, palmar sweat index) als Aktivierungsparameter in Labor- und Feldstudien</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-of-cancer-on-quality-of-life-taylor-francis-inc-9780849369773</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780849369773.jpg?v=1767770715</image:loc>
      <image:title>Effect of Cancer On Quality of Life</image:title>
      <image:caption>Book cover of: Effect of Cancer On Quality of Life</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eeo-law-and-personnel-practices-sage-publications-inc-9780761918950-arthur-gutman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761918950.jpg?v=1767770716</image:loc>
      <image:title>EEO Law and Personnel Practices</image:title>
      <image:caption>Book cover of: EEO Law and Personnel Practices. By: Arthur Gutman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wortbildungslehre-in-der-anweisung-zur-erlernung-der-slavonisch-ruischen-sprache-1705-1729-von-johann-werner-paus-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876908052</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876908052.jpg?v=1767770714</image:loc>
      <image:title>Die Wortbildungslehre in der Anweisung zur Erlernung der Slavonisch-Ruischen Sprache (1705-1729) von Johann Werner Paus</image:title>
      <image:caption>Book cover of: Die Wortbildungslehre in der Anweisung zur Erlernung der Slavonisch-Ruischen Sprache (1705-1729) von Johann Werner Paus</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-of-childhood-emotional-maltreatment-on-later-intimate-relationships-taylor-francis-ltd-9780415593694-nancy-dodge-reyome</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415593694.jpg?v=1767770715</image:loc>
      <image:title>Effect of Childhood Emotional Maltreatment on Later Intimate Relationships</image:title>
      <image:caption>Book cover of: Effect of Childhood Emotional Maltreatment on Later Intimate Relationships. By: Nancy Dodge Reyome</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-of-sulphide-on-enhanced-biological-phosphorus-removal-taylor-francis-ltd-9781138039971-francisco-rubio-rincon</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138039971.jpg?v=1767770718</image:loc>
      <image:title>Effect of Sulphide on Enhanced Biological Phosphorus Removal</image:title>
      <image:caption>Book cover of: Effect of Sulphide on Enhanced Biological Phosphorus Removal. By: Francisco Rubio-Rincon</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eec-and-the-mediterranean-countries-cambridge-university-press-9780521088947-avi-shlaim</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521088947.jpg?v=1767770715</image:loc>
      <image:title>EEC and the Mediterranean Countries</image:title>
      <image:caption>Book cover of: EEC and the Mediterranean Countries. By: Avi Shlaim</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/een-lastige-jongen-een-oorlogsverhaal-lulu-com-9780244662363-fred-van-der-wal</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780244662363.jpg?v=1767770718</image:loc>
      <image:title>Een lastige jongen (een oorlogsverhaal)</image:title>
      <image:caption>Book cover of: Een lastige jongen (een oorlogsverhaal). By: fred van der wal</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftsverfassung-der-sonderverwaltungsregion-hongkong-peter-lang-ag-9783631379561-eine-darstellung-vor-dem-hintergrund-der-wiedereingliederung-in-die-souveraenitaet-der-volksrepublik-china</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631379561.jpg?v=1767770715</image:loc>
      <image:title>Die Wirtschaftsverfassung Der Sonderverwaltungsregion Hongkong</image:title>
      <image:caption>Book cover of: Die Wirtschaftsverfassung Der Sonderverwaltungsregion Hongkong</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eeg-erp-analysis-taylor-francis-ltd-9781138077089-methods-and-applications-kamel-nidal</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138077089.jpg?v=1767770715</image:loc>
      <image:title>EEG/ERP Analysis</image:title>
      <image:caption>Book cover of: EEG/ERP Analysis. By: Kamel Nidal</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eerie-encounters-in-everyday-life-schiffer-publishing-ltd-9780764345043-angels-aliens-ghosts-and-haunts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780764345043.jpg?v=1767770715</image:loc>
      <image:title>Eerie Encounters in Everyday Life</image:title>
      <image:caption>Book cover of: Eerie Encounters in Everyday Life</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effective-academic-writing-second-edition-2-student-book-oxford-university-press-9780194323475-alice-savage</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780194323475.jpg?v=1767770717</image:loc>
      <image:title>Effective Academic Writing Second Edition: 2: Student Book</image:title>
      <image:caption>Book cover of: Effective Academic Writing Second Edition: 2: Student Book. By: Alice Savage</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eelgrass-new-directions-publishing-corporation-9780811206556-novel</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-morgan-manchester-university-press-9780719063619-inventions-of-modernity-colin-nicholson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780719063619.jpg?v=1767770717</image:loc>
      <image:title>Edwin Morgan</image:title>
      <image:caption>Book cover of: Edwin Morgan. By: Colin Nicholson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-zahlungsbereitschaft-von-urlaubsgaesten-fuer-den-naturschutz-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631330517-theorie-und-empirie-des-embedding-effektes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631330517.jpg?v=1767770716</image:loc>
      <image:title>Die Zahlungsbereitschaft von Urlaubsgaesten fuer den Naturschutz</image:title>
      <image:caption>Book cover of: Die Zahlungsbereitschaft von Urlaubsgaesten fuer den Naturschutz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wissenschaftliche-illustration-birkhauser-basel-9783034861366-von-der-hohlenmalerei-zur-computergraphik-robin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783034861366.jpg?v=1767770720</image:loc>
      <image:title>Die wissenschaftliche Illustration</image:title>
      <image:caption>Book cover of: Die wissenschaftliche Illustration. By: ROBIN</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftspolitische-willensbildung-in-der-schweiz-peter-lang-international-academic-publishers-9783261046390-ihre-moegliche-verbesserung-durch-die-schaffung-eines-eidgenoessischen-wirtschaftsrates</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261046390.jpg?v=1767770715</image:loc>
      <image:title>Die wirtschaftspolitische Willensbildung in der Schweiz</image:title>
      <image:caption>Book cover of: Die wirtschaftspolitische Willensbildung in der Schweiz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wortbildungssemantik-deverbaler-substantive-im-russischen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631441572</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631441572.jpg?v=1767770718</image:loc>
      <image:title>Die Wortbildungssemantik deverbaler Substantive im Russischen</image:title>
      <image:caption>Book cover of: Die Wortbildungssemantik deverbaler Substantive im Russischen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-howland-blashfield-ww-norton-co-9780393732818-master-american-muralist</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780393732818.jpg?v=1767770716</image:loc>
      <image:title>Edwin Howland Blashfield</image:title>
      <image:caption>Book cover of: Edwin Howland Blashfield</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-hubble-taylor-francis-ltd-9780750304238-mariner-of-the-nebulae</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750304238.jpg?v=1767770717</image:loc>
      <image:title>Edwin Hubble</image:title>
      <image:caption>Book cover of: Edwin Hubble</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/eec-and-eastern-europe-cambridge-university-press-9780521088930-avi-shlaim</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521088930.jpg?v=1767770718</image:loc>
      <image:title>EEC and Eastern Europe</image:title>
      <image:caption>Book cover of: EEC and Eastern Europe. By: Avi Shlaim</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-muir-edinburgh-university-press-9780748683086-poet-critic-and-novelist-margery-palmer-mcculloch</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780748683086.jpg?v=1767770715</image:loc>
      <image:title>Edwin Muir</image:title>
      <image:caption>Book cover of: Edwin Muir. By: Margery Palmer McCulloch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-lutyens-vintage-9780712668224-his-life-his-wife-his-work</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780712668224.jpg?v=1767770715</image:loc>
      <image:title>Edwin Lutyens</image:title>
      <image:caption>Book cover of: Edwin Lutyens</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftlichkeit-der-biomasseproduktion-zur-wasserstoffherstellung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631462027</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631462027.jpg?v=1767770718</image:loc>
      <image:title>Die Wirtschaftlichkeit der Biomasseproduktion zur Wasserstoffherstellung</image:title>
      <image:caption>Book cover of: Die Wirtschaftlichkeit der Biomasseproduktion zur Wasserstoffherstellung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftlichen-wirkungen-der-fluktuation-in-der-einzelwirtschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820456653-eine-theoretische-untersuchung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820456653.jpg?v=1767770718</image:loc>
      <image:title>Die wirtschaftlichen Wirkungen der Fluktuation in der Einzelwirtschaft</image:title>
      <image:caption>Book cover of: Die wirtschaftlichen Wirkungen der Fluktuation in der Einzelwirtschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftspolitik-in-der-weltwirtschaftskrise-1929-bis-1932-im-urteil-der-nationalsozialisten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631322604</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631322604.jpg?v=1767770716</image:loc>
      <image:title>Die Wirtschaftspolitik in der Weltwirtschaftskrise 1929 bis 1932 im Urteil der Nationalsozialisten</image:title>
      <image:caption>Book cover of: Die Wirtschaftspolitik in der Weltwirtschaftskrise 1929 bis 1932 im Urteil der Nationalsozialisten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-sandys-and-the-reform-of-english-religion-taylor-francis-ltd-9780367353155-sarah-l-bastow</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367353155.jpg?v=1767770716</image:loc>
      <image:title>Edwin Sandys and the Reform of English Religion</image:title>
      <image:caption>Book cover of: Edwin Sandys and the Reform of English Religion. By: Sarah L. Bastow</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-of-delay-and-of-intervening-events-on-reinforcement-value-taylor-francis-inc-9780898598001-quantitative-analyses-of-behavior-volume-v</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780898598001.jpg?v=1767770716</image:loc>
      <image:title>Effect of Delay and of Intervening Events on Reinforcement Value</image:title>
      <image:caption>Book cover of: Effect of Delay and of Intervening Events on Reinforcement Value</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wohlfahrtsfunktionen-der-landwirtschaft-und-deren-abgeltung-peter-lang-international-academic-publishers-9783261018236</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261018236.jpg?v=1767770718</image:loc>
      <image:title>Die Wohlfahrtsfunktionen der Landwirtschaft und deren Abgeltung</image:title>
      <image:caption>Book cover of: Die Wohlfahrtsfunktionen der Landwirtschaft und deren Abgeltung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-o-reischauer-and-the-american-discovery-of-japan-columbia-university-press-9780231143547-george-r-packard</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780231143547.jpg?v=1767770717</image:loc>
      <image:title>Edwin O. Reischauer and the American Discovery of Japan</image:title>
      <image:caption>Book cover of: Edwin O. Reischauer and the American Discovery of Japan. By: George R. Packard</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-hubble-the-discoverer-of-the-big-bang-universe-cambridge-university-press-9780521416177</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521416177.jpg?v=1767770716</image:loc>
      <image:title>Edwin Hubble, The Discoverer of the Big Bang Universe</image:title>
      <image:caption>Book cover of: Edwin Hubble, The Discoverer of the Big Bang Universe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftlichen-und-sozialen-auswirkungen-einer-industriellen-produktionsstaette-auf-eine-region-peter-lang-international-academic-publishers-9783261007032-dargestellt-am-beispiel-eines-milchverarbeitenden-betriebes-in-portugal-roman-geeser</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261007032.jpg?v=1767770717</image:loc>
      <image:title>Die wirtschaftlichen und sozialen Auswirkungen einer industriellen Produktionsstaette auf eine Region</image:title>
      <image:caption>Book cover of: Die wirtschaftlichen und sozialen Auswirkungen einer industriellen Produktionsstaette auf eine Region. By: Roman Geeser</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wissensbasierte-lagerhaltungssimulation-zur-unterstuetzung-einer-verbrauchsgesteuerten-disposition-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631446997</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631446997.jpg?v=1767770715</image:loc>
      <image:title>Die wissensbasierte Lagerhaltungssimulation zur Unterstuetzung einer verbrauchsgesteuerten Disposition</image:title>
      <image:caption>Book cover of: Die wissensbasierte Lagerhaltungssimulation zur Unterstuetzung einer verbrauchsgesteuerten Disposition</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftspolitik-der-europaeischen-union-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631351680-ansatzpunkte-und-alternativen-fiskalpolitischer-steuerung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631351680.jpg?v=1767770718</image:loc>
      <image:title>Die Wirtschaftspolitik der Europaeischen Union</image:title>
      <image:caption>Book cover of: Die Wirtschaftspolitik der Europaeischen Union</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwards-treatment-of-drinking-problems-cambridge-university-press-9781107519527-a-guide-for-the-helping-professions-keith-humphreys</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781107519527.jpg?v=1767770715</image:loc>
      <image:title>Edwards&apos; Treatment of Drinking Problems</image:title>
      <image:caption>Book cover of: Edwards&apos; Treatment of Drinking Problems. By: Keith Humphreys</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-arlington-robinson-s-letters-to-edith-brower-harvard-university-press-9780674240353</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780674240353.jpg?v=1767770718</image:loc>
      <image:title>Edwin Arlington Robinson’s Letters to Edith Brower</image:title>
      <image:caption>Book cover of: Edwin Arlington Robinson’s Letters to Edith Brower</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-j-cohn-and-the-development-of-protein-chemistry-harvard-university-press-9780674009622-with-a-detailed-account-of-his-work-on-the-fractionation-of-blood-during-and-after-world-war-ii-douglas-m-surgenor</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780674009622.jpg?v=1767770716</image:loc>
      <image:title>Edwin J. Cohn and the Development of Protein Chemistry</image:title>
      <image:caption>Book cover of: Edwin J. Cohn and the Development of Protein Chemistry. By: Douglas M. Surgenor</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftlichen-effekte-des-tourismus-dargestellt-am-beispiel-kretas-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631443521-eine-empirische-untersuchung-der-unmittelbaren-und-mittelbaren-wirtschaftlichen-wirkungen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631443521.jpg?v=1767770716</image:loc>
      <image:title>Die wirtschaftlichen Effekte des Tourismus dargestellt am Beispiel Kretas</image:title>
      <image:caption>Book cover of: Die wirtschaftlichen Effekte des Tourismus dargestellt am Beispiel Kretas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftliche-und-technische-entwicklung-der-seeschiffahrt-nobel-press-9785874006228-von-der-mitte-des-19-jahrhunderts-bis-auf-die-gegenwart</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9785874006228.jpg?v=1767770716</image:loc>
      <image:title>Die wirtschaftliche und technische Entwicklung der Seeschiffahrt</image:title>
      <image:caption>Book cover of: Die wirtschaftliche und technische Entwicklung der Seeschiffahrt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-arlington-robinson-columbia-university-press-9780231138420-a-poet-s-life-scott-donaldson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780231138420.jpg?v=1767770717</image:loc>
      <image:title>Edwin Arlington Robinson</image:title>
      <image:caption>Book cover of: Edwin Arlington Robinson. By: Scott Donaldson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-chadwick-nineteenth-century-social-reform-taylor-francis-ltd-9780415168717-d-gladstone</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415168717.jpg?v=1767770716</image:loc>
      <image:title>Edwin Chadwick: Nineteenth-Century Social Reform</image:title>
      <image:caption>Book cover of: Edwin Chadwick: Nineteenth-Century Social Reform. By: D. Gladstone</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftliche-und-soziale-revolution-in-den-unentwickelten-laendern-peter-lang-international-academic-publishers-9783261005939-zweite-ergaenzte-auflage-richard-f-behrendt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261005939.jpg?v=1767770719</image:loc>
      <image:title>Die wirtschaftliche und Soziale Revolution in den unentwickelten Laendern</image:title>
      <image:caption>Book cover of: Die wirtschaftliche und Soziale Revolution in den unentwickelten Laendern. By: Richard F. Behrendt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftliche-bedeutung-der-voegel-im-alten-reich-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631430385</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631430385.jpg?v=1767770716</image:loc>
      <image:title>Die wirtschaftliche Bedeutung der Voegel im Alten Reich</image:title>
      <image:caption>Book cover of: Die wirtschaftliche Bedeutung der Voegel im Alten Reich</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-woman-taylor-francis-ltd-9780415630818-duncan-crow</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415630818.jpg?v=1767770716</image:loc>
      <image:title>Edwardian Woman</image:title>
      <image:caption>Book cover of: Edwardian Woman. By: Duncan Crow</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwards-air-force-base-schiffer-publishing-ltd-9780764306891-open-house-at-the-usaf-flight-test-center-1957-1966-a-photo-chronicle-of-aircraft-displayed-robert-d-archer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780764306891.jpg?v=1767770716</image:loc>
      <image:title>Edwards Air Force Base</image:title>
      <image:caption>Book cover of: Edwards Air Force Base. By: Robert D. Archer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirkungsweise-verbraucherschuetzender-widerrufsrechte-peter-lang-ag-9783631356272-zur-wirksamkeit-des-verbrauchervertrages-bei-bestehendem-widerrufsrecht-nach-den-1-hwig-7-verbrkrg-und-5-tzwrg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631356272.jpg?v=1767770718</image:loc>
      <image:title>Die Wirkungsweise Verbraucherschuetzender Widerrufsrechte</image:title>
      <image:caption>Book cover of: Die Wirkungsweise Verbraucherschuetzender Widerrufsrechte</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftliche-vertretbarkeit-im-immissionsschutzrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631462249-ein-interdisziplinaerer-ansatz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631462249.jpg?v=1767770718</image:loc>
      <image:title>Die wirtschaftliche Vertretbarkeit im Immissionsschutzrecht</image:title>
      <image:caption>Book cover of: Die wirtschaftliche Vertretbarkeit im Immissionsschutzrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardians-taylor-francis-ltd-9780415061148-mr-pau-thompson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415061148.jpg?v=1767770717</image:loc>
      <image:title>Edwardians</image:title>
      <image:caption>Book cover of: Edwardians. By: Mr Pau Thompson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwards-on-god-taylor-francis-ltd-9780754665298-sebastian-rehnman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780754665298.jpg?v=1767770718</image:loc>
      <image:title>Edwards on God</image:title>
      <image:caption>Book cover of: Edwards on God. By: Sebastian Rehnman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwin-samuel-french-ltd-9780573121012-john-mortimer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780573121012.jpg?v=1767770716</image:loc>
      <image:title>Edwin</image:title>
      <image:caption>Book cover of: Edwin. By: John Mortimer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/effect-of-algal-biofilm-and-operational-conditions-on-nitrogen-removal-in-waste-stabilization-ponds-taylor-francis-ltd-9780415669467-unesco-ihe-phd-thesis-mohammed-babu</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415669467.jpg?v=1767770719</image:loc>
      <image:title>Effect of Algal Biofilm and Operational Conditions on Nitrogen Removal in Waste Stabilization Ponds</image:title>
      <image:caption>Book cover of: Effect of Algal Biofilm and Operational Conditions on Nitrogen Removal in Waste Stabilization Ponds. By: Mohammed Babu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-scrapbook-the-museum-of-brands-9780954795481</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780954795481.jpg?v=1767770718</image:loc>
      <image:title>Edwardian Scrapbook</image:title>
      <image:caption>Book cover of: Edwardian Scrapbook</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-theatre-cambridge-university-press-9780521087988-essays-on-performance-and-the-stage-michael-r-booth</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521087988.jpg?v=1767770719</image:loc>
      <image:title>Edwardian Theatre</image:title>
      <image:caption>Book cover of: Edwardian Theatre. By: Michael R. Booth</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirkung-periodisch-variierender-interstimulusintervalle-auf-die-konzentrationsleistung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631480106</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631480106.jpg?v=1767770719</image:loc>
      <image:title>Die Wirkung periodisch variierender Interstimulusintervalle auf die Konzentrationsleistung</image:title>
      <image:caption>Book cover of: Die Wirkung periodisch variierender Interstimulusintervalle auf die Konzentrationsleistung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirkungen-der-baubeschluesse-1964-1971-und-1972-in-der-schweiz-peter-lang-international-academic-publishers-9783261030153</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261030153.jpg?v=1767770716</image:loc>
      <image:title>Die Wirkungen der Baubeschluesse 1964, 1971 und 1972 in der Schweiz</image:title>
      <image:caption>Book cover of: Die Wirkungen der Baubeschluesse 1964, 1971 und 1972 in der Schweiz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-woman-taylor-francis-ltd-9780415752497-duncan-crow</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415752497.jpg?v=1767770717</image:loc>
      <image:title>Edwardian Woman</image:title>
      <image:caption>Book cover of: Edwardian Woman. By: Duncan Crow</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardians-taylor-francis-ltd-9781138151321-paul-r-thompson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138151321.jpg?v=1767770717</image:loc>
      <image:title>Edwardians</image:title>
      <image:caption>Book cover of: Edwardians. By: Paul R. Thompson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirkungen-der-geldmenge-auf-wechselkurs-und-preisniveau-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820457469-eine-dynamische-analyse-auf-der-grundlage-der-monetaeren-wechselkurstheorie</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820457469.jpg?v=1767770720</image:loc>
      <image:title>Die Wirkungen der Geldmenge auf Wechselkurs und Preisniveau</image:title>
      <image:caption>Book cover of: Die Wirkungen der Geldmenge auf Wechselkurs und Preisniveau</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaft-in-der-gedankenwelt-der-alten-griechen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631432723</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631432723.jpg?v=1767770719</image:loc>
      <image:title>Die Wirtschaft in der Gedankenwelt der alten Griechen</image:title>
      <image:caption>Book cover of: Die Wirtschaft in der Gedankenwelt der alten Griechen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wissenschaftliche-historische-ru-landforschung-im-dritten-reich-1933-1945-peter-lang-ag-9783631425039-gabriele-camphausen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631425039.jpg?v=1767770717</image:loc>
      <image:title>Die Wissenschaftliche Historische Rußlandforschung Im Dritten Reich 1933 - 1945</image:title>
      <image:caption>Book cover of: Die Wissenschaftliche Historische Rußlandforschung Im Dritten Reich 1933 - 1945. By: Gabriele Camphausen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-turn-of-mind-vintage-9780712650281-samuel-hynes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780712650281.jpg?v=1767770717</image:loc>
      <image:title>Edwardian Turn Of Mind</image:title>
      <image:caption>Book cover of: Edwardian Turn Of Mind. By: SAMUEL HYNES</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-sense-yale-university-press-9780300163353-art-design-and-performance-in-britain-1901-1910</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780300163353.jpg?v=1767770718</image:loc>
      <image:title>Edwardian Sense</image:title>
      <image:caption>Book cover of: Edwardian Sense</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-murder-the-history-press-ltd-9780752449456-ightham-and-the-morpeth-train-robbery-diane-janes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780752449456.jpg?v=1767770719</image:loc>
      <image:title>Edwardian Murder</image:title>
      <image:caption>Book cover of: Edwardian Murder. By: Diane Janes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wiener-tageszeitungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631330364-eine-dokumentation-bd-5-1945-1955-mit-einem-ueberblick-ueber-die-oesterreichische-tagespresse-der-zweiten-republik-bis-1998</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631330364.jpg?v=1767770721</image:loc>
      <image:title>Die Wiener Tageszeitungen</image:title>
      <image:caption>Book cover of: Die Wiener Tageszeitungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-murder-the-history-press-ltd-9780750947800-ightham-and-the-morpeth-train-robbery-diane-janes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750947800.jpg?v=1767770717</image:loc>
      <image:title>Edwardian Murder</image:title>
      <image:caption>Book cover of: Edwardian Murder. By: Diane Janes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirtschaftlichkeit-eines-zivilprozesses-um-eine-geldforderung-nach-bernischem-recht-peter-lang-international-academic-publishers-9783261029065</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261029065.jpg?v=1767770718</image:loc>
      <image:title>Die Wirtschaftlichkeit eines Zivilprozesses um eine Geldforderung nach bernischem Recht</image:title>
      <image:caption>Book cover of: Die Wirtschaftlichkeit eines Zivilprozesses um eine Geldforderung nach bernischem Recht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-farm-bloomsbury-publishing-plc-9780747808077</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780747808077.jpg?v=1767770719</image:loc>
      <image:title>Edwardian Farm</image:title>
      <image:caption>Book cover of: Edwardian Farm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirkung-von-problemloesungstechniken-auf-informationsverhalten-und-entscheidungseffizienz-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631488317-eine-experimentelle-untersuchung-am-beispiel-der-nutzwertanalyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631488317.jpg?v=1767770719</image:loc>
      <image:title>Die Wirkung von Problemloesungstechniken auf Informationsverhalten und Entscheidungseffizienz</image:title>
      <image:caption>Book cover of: Die Wirkung von Problemloesungstechniken auf Informationsverhalten und Entscheidungseffizienz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-opulence-yale-university-press-9780300190250-british-art-at-the-dawn-of-the-twentieth-century</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780300190250.jpg?v=1767770719</image:loc>
      <image:title>Edwardian Opulence</image:title>
      <image:caption>Book cover of: Edwardian Opulence</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wiener-zeit-springer-verlag-gmbh-9783211331149-aufsatze-beitrage-rezensionen-1926-1936-moritz-schlick</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783211331149.jpg?v=1767770721</image:loc>
      <image:title>Die Wiener Zeit</image:title>
      <image:caption>Book cover of: Die Wiener Zeit. By: Moritz Schlick</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wiedervereinigung-im-spiegel-der-tagesthemen-kommentare-von-1988-bis-1992-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631300190-eine-sprachwissenschaftliche-analyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631300190.jpg?v=1767770719</image:loc>
      <image:title>Die Wiedervereinigung im Spiegel der «Tagesthemen»-Kommentare von 1988 bis 1992</image:title>
      <image:caption>Book cover of: Die Wiedervereinigung im Spiegel der «Tagesthemen»-Kommentare von 1988 bis 1992</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-theatre-cambridge-university-press-9780521453752-essays-on-performance-and-the-stage-michael-richard-booth</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521453752.jpg?v=1767770718</image:loc>
      <image:title>Edwardian Theatre</image:title>
      <image:caption>Book cover of: Edwardian Theatre. By: Michael Richard Booth</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirkung-einer-internationalisierung-des-yen-auf-die-japanischen-finanzmaerkte-die-japanische-geldpolitik-und-die-usancen-der-fakturierung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631343760</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631343760.jpg?v=1767770719</image:loc>
      <image:title>Die Wirkung einer Internationalisierung des Yen auf die japanischen Finanzmaerkte, die japanische Geldpolitik und die Usancen der Fakturierung</image:title>
      <image:caption>Book cover of: Die Wirkung einer Internationalisierung des Yen auf die japanischen Finanzmaerkte, die japanische Geldpolitik und die Usancen der Fakturierung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-detective-taylor-francis-ltd-9780415791342-1901-15-professor-joseph-a-kestner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415791342.jpg?v=1767770719</image:loc>
      <image:title>Edwardian Detective</image:title>
      <image:caption>Book cover of: Edwardian Detective. By: Professor Joseph A. Kestner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wiederherstellung-der-deutschen-einheit-retrospektive-und-perspektive-vs-verlag-fur-sozialwissenschaften-9783663018056</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783663018056.jpg?v=1767770722</image:loc>
      <image:title>Die Wiederherstellung der deutschen Einheit - Retrospektive und Perspektive</image:title>
      <image:caption>Book cover of: Die Wiederherstellung der deutschen Einheit - Retrospektive und Perspektive</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wettbewerbsteilnahme-gemischtwirtschaftlicher-unternehmen-im-spannungsfeld-der-grundrechte-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631465219</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631465219.jpg?v=1767770720</image:loc>
      <image:title>Die Wettbewerbsteilnahme gemischtwirtschaftlicher Unternehmen im Spannungsfeld der Grundrechte</image:title>
      <image:caption>Book cover of: Die Wettbewerbsteilnahme gemischtwirtschaftlicher Unternehmen im Spannungsfeld der Grundrechte</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wiesbadener-rueckenschule-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631478943-empirische-studie-zu-den-effekten-eines-programms-aus-orthopaedischer-rueckenschule-und-psychologischer-schmerzbewaeltigung-in-der-stationaeren-rehabilit</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631478943.jpg?v=1767770719</image:loc>
      <image:title>Die Wiesbadener Rueckenschule</image:title>
      <image:caption>Book cover of: Die Wiesbadener Rueckenschule</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wiederaufnahme-von-verfahren-zu-ungunsten-des-angeklagten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631310564</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631310564.jpg?v=1767770718</image:loc>
      <image:title>Die Wiederaufnahme von Verfahren zu Ungunsten des Angeklagten</image:title>
      <image:caption>Book cover of: Die Wiederaufnahme von Verfahren zu Ungunsten des Angeklagten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-derby-the-history-press-ltd-9780752447025-a-panorama-of-provincial-town-life-100-years-ago-harry-butterton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780752447025.jpg?v=1767770720</image:loc>
      <image:title>Edwardian Derby</image:title>
      <image:caption>Book cover of: Edwardian Derby. By: Harry Butterton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wirkung-skelettmuskulaerer-aktivitaet-auf-den-atemwiderstand-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631307458-eine-psychophysiologische-untersuchung-mit-gesunden-und-asthmatischen-personen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631307458.jpg?v=1767770721</image:loc>
      <image:title>Die Wirkung skelettmuskulaerer Aktivitaet auf den Atemwiderstand</image:title>
      <image:caption>Book cover of: Die Wirkung skelettmuskulaerer Aktivitaet auf den Atemwiderstand</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-thring-taylor-francis-ltd-9780415432726-maker-of-uppingham-school-headmaster-1853-1887-w-f-rawnsley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415432726.jpg?v=1767770719</image:loc>
      <image:title>Edward Thring</image:title>
      <image:caption>Book cover of: Edward Thring. By: W.F. Rawnsley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-devon-1900-1914-the-history-press-ltd-9780750961561-before-the-lights-went-out-david-parker</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750961561.jpg?v=1767770719</image:loc>
      <image:title>Edwardian Devon 1900-1914</image:title>
      <image:caption>Book cover of: Edwardian Devon 1900-1914. By: David Parker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-young-night-thoughts-cambridge-university-press-9780521069670-edward-young</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521069670.jpg?v=1767770720</image:loc>
      <image:title>Edward Young: Night Thoughts</image:title>
      <image:caption>Book cover of: Edward Young: Night Thoughts. By: Edward Young</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-crisis-bloomsbury-publishing-plc-9780333595435-britain-1901-14</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780333595435.jpg?v=1767770721</image:loc>
      <image:title>Edwardian Crisis</image:title>
      <image:caption>Book cover of: Edwardian Crisis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-thomas-prose-writings-a-selected-edition-oxford-university-press-9780198738633-volume-v-critical-studies-swinburne-and-pater-francis-o-gorman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780198738633.jpg?v=1767770719</image:loc>
      <image:title>Edward Thomas: Prose Writings: A Selected Edition</image:title>
      <image:caption>Book cover of: Edward Thomas: Prose Writings: A Selected Edition. By: Francis O&apos;Gorman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-thomas-prose-writings-a-selected-edition-oxford-university-press-9780199588114-volume-iii-biographies-jem-poster</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780199588114.jpg?v=1767770723</image:loc>
      <image:title>Edward Thomas: Prose Writings: A Selected Edition</image:title>
      <image:caption>Book cover of: Edward Thomas: Prose Writings: A Selected Edition. By: Jem Poster</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wettbewerbsverhaeltnisse-auf-dem-markt-fuer-datenverarbeitungsprogramme-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820468847</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820468847.jpg?v=1767770721</image:loc>
      <image:title>Die Wettbewerbsverhaeltnisse auf dem Markt fuer Datenverarbeitungsprogramme</image:title>
      <image:caption>Book cover of: Die Wettbewerbsverhaeltnisse auf dem Markt fuer Datenverarbeitungsprogramme</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-vii-s-children-the-history-press-ltd-9780750934633</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750934633.jpg?v=1767770720</image:loc>
      <image:title>Edward VII&apos;s Children</image:title>
      <image:caption>Book cover of: Edward VII&apos;s Children</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-v-the-history-press-ltd-9780752419961-the-prince-in-the-tower-m-a-hicks</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780752419961.jpg?v=1767770718</image:loc>
      <image:title>Edward V</image:title>
      <image:caption>Book cover of: Edward V. By: M. A. Hicks</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-trencom-s-nose-pan-macmillan-9780230772229-a-novel-of-history-dark-intrigue-and-cheese</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780230772229.jpg?v=1767770719</image:loc>
      <image:title>Edward Trencom&apos;s Nose</image:title>
      <image:caption>Book cover of: Edward Trencom&apos;s Nose</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-thomas-orion-publishing-co-9780460878777-edward-thomas</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780460878777.jpg?v=1767770721</image:loc>
      <image:title>Edward Thomas</image:title>
      <image:caption>Book cover of: Edward Thomas. By: Edward Thomas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-the-second-manchester-university-press-9780719030895-christopher-marlowe-christopher-marlowe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780719030895.jpg?v=1767770721</image:loc>
      <image:title>Edward the Second</image:title>
      <image:caption>Book cover of: Edward the Second. By: Christopher Marlowe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edwardian-carol-book-oxford-university-press-9780193869660-12-carols-for-mixed-voices</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780193869660.jpg?v=1767770721</image:loc>
      <image:title>Edwardian Carol Book</image:title>
      <image:caption>Book cover of: Edwardian Carol Book</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-thompson-of-the-lner-stenlake-publishing-9780853616726-peter-grafton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780853616726.jpg?v=1767770720</image:loc>
      <image:title>Edward Thompson of the LNER</image:title>
      <image:caption>Book cover of: Edward Thompson of the LNER. By: Peter Grafton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-thring-taylor-francis-ltd-9780415761765-maker-of-uppingham-school-headmaster-1853-1887-w-f-rawnsley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415761765.jpg?v=1767770719</image:loc>
      <image:title>Edward Thring</image:title>
      <image:caption>Book cover of: Edward Thring. By: W. F. Rawnsley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-thomas-the-history-press-ltd-9780750946599-the-last-four-years-the-story-of-a-friendship</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750946599.jpg?v=1767770721</image:loc>
      <image:title>Edward Thomas</image:title>
      <image:caption>Book cover of: Edward Thomas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wettbewerbsklausel-des-65-nr-3-ao-als-schutznorm-zugunsten-nicht-beguenstigter-konkurrenten-gemeinnuetziger-koerperschaften-peter-lang-ag-9783631502471</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631502471.jpg?v=1767770720</image:loc>
      <image:title>Die Wettbewerbsklausel Des § 65 Nr. 3 Ao ALS Schutznorm Zugunsten Nicht Beguenstigter Konkurrenten Gemeinnuetziger Koerperschaften</image:title>
      <image:caption>Book cover of: Die Wettbewerbsklausel Des § 65 Nr. 3 Ao ALS Schutznorm Zugunsten Nicht Beguenstigter Konkurrenten Gemeinnuetziger Koerperschaften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-the-elder-taylor-francis-ltd-9780415214971-899-924</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415214971.jpg?v=1767770720</image:loc>
      <image:title>Edward the Elder</image:title>
      <image:caption>Book cover of: Edward the Elder</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wettbewerbsrechtliche-beurteilung-von-zugaben-peter-lang-ag-9783631352502-ein-beitrag-zur-verfassungsrechtlichen-problematik-der-zugabeverordnung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631352502.jpg?v=1767770723</image:loc>
      <image:title>Die Wettbewerbsrechtliche Beurteilung Von Zugaben</image:title>
      <image:caption>Book cover of: Die Wettbewerbsrechtliche Beurteilung Von Zugaben</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wertpapierboerse-und-ihr-traeger-peter-lang-ag-9783631529539-ein-beitrag-zur-inhaltsbestimmung-der-betriebspflicht-und-zur-erwerbswirtschaftlichen-betaetigung-des-traegers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631529539.jpg?v=1767770723</image:loc>
      <image:title>Die Wertpapierboerse Und Ihr Traeger</image:title>
      <image:caption>Book cover of: Die Wertpapierboerse Und Ihr Traeger</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wettbewerbsfaehigkeit-der-amerikanischen-automobilindustrie-am-ende-der-80er-jahre-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631454459</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631454459.jpg?v=1767770720</image:loc>
      <image:title>Die Wettbewerbsfaehigkeit der amerikanischen Automobilindustrie am Ende der 80er Jahre</image:title>
      <image:caption>Book cover of: Die Wettbewerbsfaehigkeit der amerikanischen Automobilindustrie am Ende der 80er Jahre</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-the-second-cambridge-university-press-9781107426672-christopher-marlowe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781107426672.jpg?v=1767770720</image:loc>
      <image:title>Edward the Second</image:title>
      <image:caption>Book cover of: Edward the Second. By: Christopher Marlowe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-thomas-university-of-wales-press-9780708324035-the-origins-of-his-poetry</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780708324035.jpg?v=1767770721</image:loc>
      <image:title>Edward Thomas</image:title>
      <image:caption>Book cover of: Edward Thomas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-taylor-s-gods-determinations-and-preparatory-meditations-kent-state-university-press-9780873387491-a-critical-edition</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780873387491.jpg?v=1767770722</image:loc>
      <image:title>Edward Taylor&apos;s &quot;&quot;Gods Determinations&quot;&quot; and &quot;&quot;Preparatory Meditations</image:title>
      <image:caption>Book cover of: Edward Taylor&apos;s &quot;&quot;Gods Determinations&quot;&quot; and &quot;&quot;Preparatory Meditations</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wettbewerbs-und-rabattrechtliche-beurteilung-der-preisspaltung-peter-lang-international-academic-publishers-9783261010230-hans-goll</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261010230.jpg?v=1767770723</image:loc>
      <image:title>Die wettbewerbs- und rabattrechtliche Beurteilung der Preisspaltung</image:title>
      <image:caption>Book cover of: Die wettbewerbs- und rabattrechtliche Beurteilung der Preisspaltung. By: Hans Goll</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-the-confessor-yale-university-press-9780300071566-frank-barlow</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780300071566.jpg?v=1767770721</image:loc>
      <image:title>Edward the Confessor</image:title>
      <image:caption>Book cover of: Edward the Confessor. By: Frank Barlow</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-the-elder-taylor-francis-ltd-9780415214964-899-924</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415214964.jpg?v=1767770721</image:loc>
      <image:title>Edward the Elder</image:title>
      <image:caption>Book cover of: Edward the Elder</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wertpapierhandelsaufsicht-nach-dem-zweiten-finanzmarktfoerderungsgesetz-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631334416</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631334416.jpg?v=1767770721</image:loc>
      <image:title>Die Wertpapierhandelsaufsicht nach dem Zweiten Finanzmarktfoerderungsgesetz</image:title>
      <image:caption>Book cover of: Die Wertpapierhandelsaufsicht nach dem Zweiten Finanzmarktfoerderungsgesetz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-schillebeeckx-bloomsbury-publishing-plc-9780826474278-a-theologican-in-his-history-erik-borgman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780826474278.jpg?v=1767770721</image:loc>
      <image:title>Edward Schillebeeckx</image:title>
      <image:caption>Book cover of: Edward Schillebeeckx. By: Erik Borgman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-westfaelischen-fabrikengerichtsdeputationen-vorbilder-werdegang-und-scheitern-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820471113-vorbilder-werdegang-und-scheitern</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820471113.jpg?v=1767770722</image:loc>
      <image:title>Die westfaelischen Fabrikengerichtsdeputationen- - Vorbilder, Werdegang und Scheitern -</image:title>
      <image:caption>Book cover of: Die westfaelischen Fabrikengerichtsdeputationen- - Vorbilder, Werdegang und Scheitern -</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-weltbildgesteuerte-kulturelle-zeit-und-raumkonstruktion-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876906430-eine-empirische-untersuchung-an-polnischem-material</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876906430.jpg?v=1767770723</image:loc>
      <image:title>Die weltbildgesteuerte kulturelle Zeit- und Raumkonstruktion</image:title>
      <image:caption>Book cover of: Die weltbildgesteuerte kulturelle Zeit- und Raumkonstruktion</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wergelder-2-kodansha-america-inc-9781632361967-hiroaki-samura</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781632361967.jpg?v=1767770723</image:loc>
      <image:title>Die Wergelder 2</image:title>
      <image:caption>Book cover of: Die Wergelder 2. By: Hiroaki Samura</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-schillebeeckx-and-contemporary-theology-bloomsbury-publishing-plc-9780567181602-frederiek-depoortere</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780567181602.jpg?v=1767770722</image:loc>
      <image:title>Edward Schillebeeckx and Contemporary Theology</image:title>
      <image:caption>Book cover of: Edward Schillebeeckx and Contemporary Theology. By: Frederiek Depoortere</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-stanly-the-university-of-alabama-press-9780817312916-whiggerys-tarheel-conquer-norman-brown</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780817312916.jpg?v=1767770720</image:loc>
      <image:title>Edward Stanly</image:title>
      <image:caption>Book cover of: Edward Stanly. By: Norman Brown</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wergelder-1-kodansha-america-inc-9781632361950-hiroaki-samura</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781632361950.jpg?v=1767770721</image:loc>
      <image:title>Die Wergelder 1</image:title>
      <image:caption>Book cover of: Die Wergelder 1. By: Hiroaki Samura</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-sorin-university-of-notre-dame-press-9780268027599-marvin-r-o-connell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780268027599.jpg?v=1767770722</image:loc>
      <image:title>Edward Sorin</image:title>
      <image:caption>Book cover of: Edward Sorin. By: Marvin R. O&apos;Connell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-and-the-religious-effects-of-culture-cambridge-university-press-9780521770521-william-d-hart</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521770521.jpg?v=1767770721</image:loc>
      <image:title>Edward Said and the Religious Effects of Culture</image:title>
      <image:caption>Book cover of: Edward Said and the Religious Effects of Culture. By: William D. Hart</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wettbewerbsfaehigkeit-des-finanzplatzes-frankfurt-im-internationalen-vergleich-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631455043</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631455043.jpg?v=1767770724</image:loc>
      <image:title>Die Wettbewerbsfaehigkeit des Finanzplatzes Frankfurt im internationalen Vergleich</image:title>
      <image:caption>Book cover of: Die Wettbewerbsfaehigkeit des Finanzplatzes Frankfurt im internationalen Vergleich</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-sapir-taylor-francis-ltd-9780415255073-critical-assessments-of-leading-linguists-koerner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415255073.jpg?v=1767770723</image:loc>
      <image:title>Edward Sapir</image:title>
      <image:caption>Book cover of: Edward Sapir. By: Koerner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-and-the-work-of-the-critic-duke-university-press-9780822325222-speaking-truth-to-power</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780822325222.jpg?v=1767770722</image:loc>
      <image:title>Edward Said and the Work of the Critic</image:title>
      <image:caption>Book cover of: Edward Said and the Work of the Critic</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-welt-der-slaven-jahrgang-lvi-2011-heft-1-peter-lang-ag-9783631738962</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631738962.jpg?v=1767770722</image:loc>
      <image:title>Die Welt der Slaven. Jahrgang LVI (2011) Heft 1</image:title>
      <image:caption>Book cover of: Die Welt der Slaven. Jahrgang LVI (2011) Heft 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-and-the-religious-effects-of-culture-cambridge-university-press-9780521778107-william-d-hart</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521778107.jpg?v=1767770722</image:loc>
      <image:title>Edward Said and the Religious Effects of Culture</image:title>
      <image:caption>Book cover of: Edward Said and the Religious Effects of Culture. By: William D. Hart</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-and-the-literary-social-and-political-world-taylor-francis-ltd-9780415647441</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415647441.jpg?v=1767770724</image:loc>
      <image:title>Edward Said and the Literary, Social, and Political World</image:title>
      <image:caption>Book cover of: Edward Said and the Literary, Social, and Political World</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-s-translocations-taylor-francis-ltd-9780415886376-essays-in-secular-criticism-edward-said-symposium-locations-readings-legacies-2008-berlin-germany</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415886376.jpg?v=1767770723</image:loc>
      <image:title>Edward Said&apos;s Translocations</image:title>
      <image:caption>Book cover of: Edward Said&apos;s Translocations. By: Edward Said Symposium: Locations, Readings, Legacies (2008 Berlin, Germany)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-and-the-literary-social-and-political-world-taylor-francis-ltd-9780415963237</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415963237.jpg?v=1767770724</image:loc>
      <image:title>Edward Said and the Literary, Social, and Political World</image:title>
      <image:caption>Book cover of: Edward Said and the Literary, Social, and Political World</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-weltmachte-und-deutschland-springer-verlag-berlin-and-heidelberg-gmbh-co-kg-9783476998569-geschichte-der-jungsten-vergangenheit-1945-1955-wilhelm-cornides</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783476998569.jpg?v=1767770722</image:loc>
      <image:title>Die Weltmachte und Deutschland</image:title>
      <image:caption>Book cover of: Die Weltmachte und Deutschland. By: Wilhelm Cornides</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-s-translocations-taylor-francis-ltd-9781138851627-essays-in-secular-criticism</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138851627.jpg?v=1767770722</image:loc>
      <image:title>Edward Said&apos;s Translocations</image:title>
      <image:caption>Book cover of: Edward Said&apos;s Translocations</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-taylor-francis-ltd-9780415476874-bill-ashcroft</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415476874.jpg?v=1767770727</image:loc>
      <image:title>Edward Said</image:title>
      <image:caption>Book cover of: Edward Said. By: Bill Ashcroft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wettbewerbspolitische-behandlung-der-leitungsgebundenen-energiewirtschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820495515-dargestellt-am-beispiel-der-fernwaermewirtschaft-der-bundesrepublik-deutschland</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820495515.jpg?v=1767770723</image:loc>
      <image:title>Die wettbewerbspolitische Behandlung der leitungsgebundenen Energiewirtschaft</image:title>
      <image:caption>Book cover of: Die wettbewerbspolitische Behandlung der leitungsgebundenen Energiewirtschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-john-wiley-and-sons-ltd-9780745620190-a-critical-introduction</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780745620190.jpg?v=1767770721</image:loc>
      <image:title>Edward Said</image:title>
      <image:caption>Book cover of: Edward Said</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-schillebeeckx-and-hans-frei-wilfrid-laurier-university-press-9780889203761-a-conversation-on-method-and-christology-marguerite-abdul-masih</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780889203761.jpg?v=1767770723</image:loc>
      <image:title>Edward Schillebeeckx and Hans Frei</image:title>
      <image:caption>Book cover of: Edward Schillebeeckx and Hans Frei. By: Marguerite Abdul-Masih</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-welt-der-slaven-jahrgang-lvii-2012-heft-2-peter-lang-ag-9783631739082</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631739082.jpg?v=1767770723</image:loc>
      <image:title>Die Welt der Slaven. Jahrgang LVII (2012) Heft 2</image:title>
      <image:caption>Book cover of: Die Welt der Slaven. Jahrgang LVII (2012) Heft 2</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wertzeichenfaelschung-peter-lang-ag-9783631559932-johannes-landes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631559932.jpg?v=1767770724</image:loc>
      <image:title>Die Wertzeichenfaelschung</image:title>
      <image:caption>Book cover of: Die Wertzeichenfaelschung. By: Johannes Landes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-welt-der-slaven-jahrgang-lix-2014-heft-1-peter-lang-ag-9783631739112</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631739112.jpg?v=1767770724</image:loc>
      <image:title>Die Welt der Slaven. Jahrgang LIX (2014) Heft 1</image:title>
      <image:caption>Book cover of: Die Welt der Slaven. Jahrgang LIX (2014) Heft 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-werte-der-schweizer-peter-lang-international-academic-publishers-9783261044976-herausgegeben-von-anna-melich-vorwort-von-flavio-cotti-praesident-der-eidgenossenschaft-anna-melich</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261044976.jpg?v=1767770725</image:loc>
      <image:title>Die Werte der Schweizer</image:title>
      <image:caption>Book cover of: Die Werte der Schweizer. By: Anna Melich</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-the-university-of-chicago-press-9780226532035-continuing-the-conversation</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226532035.jpg?v=1767770723</image:loc>
      <image:title>Edward Said</image:title>
      <image:caption>Book cover of: Edward Said</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wertschoepfung-als-zielgroesse-der-regionalen-wirtschaftspolitik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820485363-ein-beitrag-zur-rationalisierung-der-berlinfoerderung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820485363.jpg?v=1767770723</image:loc>
      <image:title>Die Wertschoepfung als Zielgroesse der regionalen Wirtschaftspolitik</image:title>
      <image:caption>Book cover of: Die Wertschoepfung als Zielgroesse der regionalen Wirtschaftspolitik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-welt-der-slaven-jahrgang-2014-peter-lang-pub-inc-9783631743669-peter-rehder</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631743669.jpg?v=1767770723</image:loc>
      <image:title>Die Welt Der Slaven. Jahrgang 2014</image:title>
      <image:caption>Book cover of: Die Welt Der Slaven. Jahrgang 2014. By: Peter Rehder</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-taylor-francis-ltd-9780415476898-bill-ashcroft</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415476898.jpg?v=1767770725</image:loc>
      <image:title>Edward Said</image:title>
      <image:caption>Book cover of: Edward Said. By: Bill Ashcroft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-weiterbeschaeftigungsverfuegung-nach-102-abs-5-satz-1-betrvg-peter-lang-ag-9783631342268</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631342268.jpg?v=1767770725</image:loc>
      <image:title>Die Weiterbeschaeftigungsverfuegung Nach 102 Abs. 5 Satz 1 Betrvg</image:title>
      <image:caption>Book cover of: Die Weiterbeschaeftigungsverfuegung Nach 102 Abs. 5 Satz 1 Betrvg</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-welt-der-slaven-2011-peter-lang-pub-inc-9783631739037-schwerpunkt-psychedelik-und-slavische-literaturen-peter-rehder</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631739037.jpg?v=1767770722</image:loc>
      <image:title>Die Welt Der Slaven 2011</image:title>
      <image:caption>Book cover of: Die Welt Der Slaven 2011. By: Peter Rehder</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-welt-als-entwurf-wiley-vch-verlag-gmbh-9783433031162-schriften-zum-design-otl-aicher</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783433031162.jpg?v=1767770723</image:loc>
      <image:title>die welt als entwurf</image:title>
      <image:caption>Book cover of: die welt als entwurf. By: Otl Aicher</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-taylor-francis-ltd-9780415902649-the-charisma-of-criticism-harold-a-veeser-h-aram-veeser</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415902649.jpg?v=1767770724</image:loc>
      <image:title>Edward Said</image:title>
      <image:caption>Book cover of: Edward Said. By: Harold A Veeser, H. Aram Veeser</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-at-the-limits-state-university-of-new-york-press-9780791459669</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-university-of-california-press-9780520258907-a-legacy-of-emancipation-and-representation-adel-iskandar</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780520258907.jpg?v=1767770725</image:loc>
      <image:title>Edward Said</image:title>
      <image:caption>Book cover of: Edward Said. By: Adel Iskandar</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-s-curtis-and-the-north-american-indian-incorporated-cambridge-university-press-9780521775731</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521775731.jpg?v=1767770725</image:loc>
      <image:title>Edward S. Curtis and the North American Indian, Incorporated</image:title>
      <image:caption>Book cover of: Edward S. Curtis and the North American Indian, Incorporated</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-warnfunktion-des-abschlusspruefers-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783899756906-christian-heintze</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783899756906.jpg?v=1767770723</image:loc>
      <image:title>Die Warnfunktion Des Abschlusspruefers</image:title>
      <image:caption>Book cover of: Die Warnfunktion Des Abschlusspruefers. By: Christian Heintze</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-weinsteuer-und-ihre-harmonisierung-in-den-europaeischen-gemeinschaften-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631446331</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631446331.jpg?v=1767770725</image:loc>
      <image:title>Die Weinsteuer und ihre Harmonisierung in den Europaeischen Gemeinschaften</image:title>
      <image:caption>Book cover of: Die Weinsteuer und ihre Harmonisierung in den Europaeischen Gemeinschaften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-welt-des-islam-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631405789-rezipiert-und-dargestellt-durch-jos-freiherr-von-hammer-purgstall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631405789.jpg?v=1767770724</image:loc>
      <image:title>Die Welt des Islam</image:title>
      <image:caption>Book cover of: Die Welt des Islam</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-weisungsbindungen-der-gemeindevertreter-in-aufsichtsraeten-kommunaler-unternehmen-peter-lang-ag-9783631390436-ein-beitrag-zur-beseitigung-von-widerspruechen-bei-der-auslegung-des-gesellschafts-des-kommunal-und-des-beamtenrechts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631390436.jpg?v=1767770725</image:loc>
      <image:title>Die Weisungsbindungen Der Gemeindevertreter in Aufsichtsraeten Kommunaler Unternehmen</image:title>
      <image:caption>Book cover of: Die Weisungsbindungen Der Gemeindevertreter in Aufsichtsraeten Kommunaler Unternehmen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-sage-publications-inc-9780761970545</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761970545.jpg?v=1767770725</image:loc>
      <image:title>Edward Said</image:title>
      <image:caption>Book cover of: Edward Said</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-warenstruktur-des-aussenhandels-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820488104-theoretische-konzepte-und-empirische-untersuchungen-am-beispiel-oesterreich</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820488104.jpg?v=1767770727</image:loc>
      <image:title>Die Warenstruktur des Aussenhandels</image:title>
      <image:caption>Book cover of: Die Warenstruktur des Aussenhandels</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wechselbeziehungen-in-der-landwirtschaftlichen-familienwirtschaft-aus-haushaltsoekonomischer-sicht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631441121</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631441121.jpg?v=1767770725</image:loc>
      <image:title>Die Wechselbeziehungen in der landwirtschaftlichen Familienwirtschaft aus haushaltsoekonomischer Sicht</image:title>
      <image:caption>Book cover of: Die Wechselbeziehungen in der landwirtschaftlichen Familienwirtschaft aus haushaltsoekonomischer Sicht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wahrnehmung-ueberoertlicher-sozialhilfeaufgaben-durch-hoehere-kommunalverbaende-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631453735-am-beispiel-des-landeswohlfahrtsverbandes-hessen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631453735.jpg?v=1767770725</image:loc>
      <image:title>Die Wahrnehmung ueberoertlicher Sozialhilfeaufgaben durch hoehere Kommunalverbaende</image:title>
      <image:caption>Book cover of: Die Wahrnehmung ueberoertlicher Sozialhilfeaufgaben durch hoehere Kommunalverbaende</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-s-corwin-s-constitution-and-what-it-means-today-princeton-university-press-9780691027586-1978-edition</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780691027586.jpg?v=1767770725</image:loc>
      <image:title>Edward S. Corwin&apos;s Constitution and What It Means Today</image:title>
      <image:caption>Book cover of: Edward S. Corwin&apos;s Constitution and What It Means Today</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wandlung-der-badekur-zur-gesundheitsbildung-im-kurort-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631459508</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631459508.jpg?v=1767770726</image:loc>
      <image:title>Die Wandlung der Badekur zur Gesundheitsbildung im Kurort</image:title>
      <image:caption>Book cover of: Die Wandlung der Badekur zur Gesundheitsbildung im Kurort</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-warenfoermigkeit-kindlicher-spielarbeit-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820402315-die-verformung-des-spiels-im-lichte-industrieller-erkenntnisinteressen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820402315.jpg?v=1767770725</image:loc>
      <image:title>Die Warenfoermigkeit kindlicher Spielarbeit</image:title>
      <image:caption>Book cover of: Die Warenfoermigkeit kindlicher Spielarbeit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wahrheit-uber-begeisterte-mitarbeiter-wiley-vch-verlag-gmbh-9783527508839-ein-lehrstuck-fur-manager-patrick-m-lencioni</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783527508839.jpg?v=1767770729</image:loc>
      <image:title>Die Wahrheit uber begeisterte Mitarbeiter</image:title>
      <image:caption>Book cover of: Die Wahrheit uber begeisterte Mitarbeiter. By: Patrick M. Lencioni</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wahrnehmung-von-baulich-raeumlicher-umwelt-bei-kindern-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820487695-eine-untersuchung-zum-vorstellungsbild-des-klassenzimmers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820487695.jpg?v=1767770725</image:loc>
      <image:title>Die Wahrnehmung von baulich-raeumlicher Umwelt bei Kindern</image:title>
      <image:caption>Book cover of: Die Wahrnehmung von baulich-raeumlicher Umwelt bei Kindern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wahrheit-des-scheins-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820490251-zur-ambivalenz-des-schoenen-in-der-deutschen-literatur-und-aesthetik-um-1800</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820490251.jpg?v=1767770725</image:loc>
      <image:title>Die Wahrheit des Scheins</image:title>
      <image:caption>Book cover of: Die Wahrheit des Scheins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wehrverfassung-des-dritten-reiches-und-der-ddr-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631327739-ein-vergleich-der-rechtlichen-strukturen-totalitaerer-herrschaft</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631327739.jpg?v=1767770725</image:loc>
      <image:title>Die Wehrverfassung des Dritten Reiches und der DDR</image:title>
      <image:caption>Book cover of: Die Wehrverfassung des Dritten Reiches und der DDR</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wahl-des-rentenalters-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631489031-theoretische-und-empirische-analyse-des-rentenzugangsverhaltens-in-west-und-ostdeutschland</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631489031.jpg?v=1767770728</image:loc>
      <image:title>Die Wahl des Rentenalters</image:title>
      <image:caption>Book cover of: Die Wahl des Rentenalters</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-welt-der-slaven-jahrgang-peter-lang-pub-inc-9783631743065</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wandlungen-krsnas-zum-hoechsten-gott-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631307175-philologische-studie-zur-krsna-gopala-legende</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631307175.jpg?v=1767770725</image:loc>
      <image:title>Die Wandlungen Krsnas zum hoechsten Gott</image:title>
      <image:caption>Book cover of: Die Wandlungen Krsnas zum hoechsten Gott</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-s-curtis-and-the-north-american-indian-project-in-the-field-university-of-nebraska-press-9780803234680</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780803234680.jpg?v=1767770724</image:loc>
      <image:title>Edward S. Curtis and the North American Indian Project in the Field</image:title>
      <image:caption>Book cover of: Edward S. Curtis and the North American Indian Project in the Field</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-palmer-s-arkansaw-mounds-the-university-of-alabama-press-9780817356125-palmer-edward-edward-palmer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780817356125.jpg?v=1767770727</image:loc>
      <image:title>EDWARD PALMER&apos;S ARKANSAW MOUNDS</image:title>
      <image:caption>Book cover of: EDWARD PALMER&apos;S ARKANSAW MOUNDS. By: Palmer, Edward, Edward Palmer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-i-and-the-governance-of-england-1272-1307-cambridge-university-press-9781108441216-caroline-burt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781108441216.jpg?v=1767770728</image:loc>
      <image:title>Edward I and the Governance of England, 1272–1307</image:title>
      <image:caption>Book cover of: Edward I and the Governance of England, 1272–1307. By: Caroline Burt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-lear-and-the-play-of-poetry-oxford-university-press-9780198708568</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780198708568.jpg?v=1767770726</image:loc>
      <image:title>Edward Lear and the Play of Poetry</image:title>
      <image:caption>Book cover of: Edward Lear and the Play of Poetry</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wahlvorstaende-fuer-die-wahlen-des-betriebsrats-des-sprecherausschusses-und-des-aufsichtsrats-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631480229-kay-uwe-jacobs</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631480229.jpg?v=1767770727</image:loc>
      <image:title>Die Wahlvorstaende fuer die Wahlen des Betriebsrats, des Sprecherausschusses und des Aufsichtsrats</image:title>
      <image:caption>Book cover of: Die Wahlvorstaende fuer die Wahlen des Betriebsrats, des Sprecherausschusses und des Aufsichtsrats. By: Kay-Uwe Jacobs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-ruscha-yale-university-press-9780300214666-catalogue-raisonne-of-the-works-on-paper-volume-two-1977-1997-lisa-turvey</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780300214666.jpg?v=1767770726</image:loc>
      <image:title>Edward Ruscha</image:title>
      <image:caption>Book cover of: Edward Ruscha. By: Lisa Turvey</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wahrheitsfindung-im-ermittlungsverfahren-peter-lang-ag-9783631516041-ro-seop-park</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631516041.jpg?v=1767770726</image:loc>
      <image:title>Die Wahrheitsfindung Im Ermittlungsverfahren</image:title>
      <image:caption>Book cover of: Die Wahrheitsfindung Im Ermittlungsverfahren. By: Ro-Seop Park</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-poeton-the-winnowing-of-white-witchcraft-arizona-center-for-medieval-renaissance-studies-us-9780866985673-edward-poeton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780866985673.jpg?v=1767770727</image:loc>
      <image:title>Edward Poeton: The Winnowing of White Witchcraft</image:title>
      <image:caption>Book cover of: Edward Poeton: The Winnowing of White Witchcraft. By: Edward Poeton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-ii-penguin-monarchs-penguin-books-ltd-9780141989914-the-terrors-of-kingship</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780141989914.jpg?v=1767770724</image:loc>
      <image:title>Edward II (Penguin Monarchs)</image:title>
      <image:caption>Book cover of: Edward II (Penguin Monarchs)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wahl-der-optimalen-waermeversorgungskonfiguration-als-betriebswirtschftliches-produktions-und-investitionsproblem-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820474329</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820474329.jpg?v=1767770729</image:loc>
      <image:title>Die Wahl der optimalen Waermeversorgungskonfiguration als betriebswirtschftliches Produktions- und Investitionsproblem</image:title>
      <image:caption>Book cover of: Die Wahl der optimalen Waermeversorgungskonfiguration als betriebswirtschftliches Produktions- und Investitionsproblem</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorzeitige-loesung-von-berufsausbildungsvertraegen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820462432-empirisch-analytische-untersuchung-der-gruende-und-einflussfaktoren-beim-abbruch-der-berufsausbildung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820462432.jpg?v=1767770726</image:loc>
      <image:title>Die vorzeitige Loesung von Berufsausbildungsvertraegen</image:title>
      <image:caption>Book cover of: Die vorzeitige Loesung von Berufsausbildungsvertraegen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-norgate-yale-university-press-9780300069136-miniatura-or-the-art-of-limning</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780300069136.jpg?v=1767770726</image:loc>
      <image:title>Edward Norgate</image:title>
      <image:caption>Book cover of: Edward Norgate</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-iii-yale-university-press-9780300194081-w-mark-ormrod</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780300194081.jpg?v=1767770727</image:loc>
      <image:title>Edward III</image:title>
      <image:caption>Book cover of: Edward III. By: W. Mark Ormrod</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wahlrechtsproblematik-im-handelsrechtlichen-jahresabschlu-der-kapitalgesellschaft-peter-lang-ag-9783631342176-markus-kothes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631342176.jpg?v=1767770727</image:loc>
      <image:title>Die Wahlrechtsproblematik Im Handelsrechtlichen Jahresabschluß Der Kapitalgesellschaft</image:title>
      <image:caption>Book cover of: Die Wahlrechtsproblematik Im Handelsrechtlichen Jahresabschluß Der Kapitalgesellschaft. By: Markus Kothes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-said-university-of-california-press-9780520245464-a-legacy-of-emancipation-and-representation-adel-iskandar</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780520245464.jpg?v=1767770726</image:loc>
      <image:title>Edward Said</image:title>
      <image:caption>Book cover of: Edward Said. By: Adel Iskandar</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-pugh-of-ruthin-1763-1813-university-of-wales-press-9780708325667-a-native-artist-john-barrell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780708325667.jpg?v=1767770727</image:loc>
      <image:title>Edward Pugh of Ruthin 1763-1813</image:title>
      <image:caption>Book cover of: Edward Pugh of Ruthin 1763-1813. By: John Barrell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-ii-yale-university-press-9780300178029</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780300178029.jpg?v=1767770726</image:loc>
      <image:title>Edward II</image:title>
      <image:caption>Book cover of: Edward II</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-ii-the-history-press-ltd-9780752433196-roy-martin-haines</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780752433196.jpg?v=1767770726</image:loc>
      <image:title>Edward II</image:title>
      <image:caption>Book cover of: Edward II. By: Roy Martin Haines</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wahrscheinlichkeit-paradoxer-abstimmungsergebnisse-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906750286</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906750286.jpg?v=1767770727</image:loc>
      <image:title>Die Wahrscheinlichkeit paradoxer Abstimmungsergebnisse</image:title>
      <image:caption>Book cover of: Die Wahrscheinlichkeit paradoxer Abstimmungsergebnisse</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wahre-und-die-falsche-unfehlbarkeit-der-papste-nobel-press-9785875839498-zur-abwehr-gegen-hrn-prof-dr-schulte</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9785875839498.jpg?v=1767770727</image:loc>
      <image:title>Die wahre und die falsche Unfehlbarkeit der Papste</image:title>
      <image:caption>Book cover of: Die wahre und die falsche Unfehlbarkeit der Papste</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-lear-the-history-press-ltd-9780750937443-the-life-of-a-wanderer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750937443.jpg?v=1767770725</image:loc>
      <image:title>Edward Lear</image:title>
      <image:caption>Book cover of: Edward Lear</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-i-and-the-governance-of-england-1272-1307-cambridge-university-press-9780521889995-caroline-burt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521889995.jpg?v=1767770728</image:loc>
      <image:title>Edward I and the Governance of England, 1272–1307</image:title>
      <image:caption>Book cover of: Edward I and the Governance of England, 1272–1307. By: Caroline Burt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-pugh-of-ruthin-1763-1813-university-of-wales-press-9780708325674-a-native-artist</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780708325674.jpg?v=1767770725</image:loc>
      <image:title>Edward Pugh of Ruthin 1763-1813</image:title>
      <image:caption>Book cover of: Edward Pugh of Ruthin 1763-1813</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-waehrungsumrechnung-im-rahmen-der-internationalen-konzernrechnungslegung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820483727-zur-entwicklung-von-grundsaetzen-ordnungsmaessiger-waehrungsumrechnung-und-eines-darauf-aufbauenden-umrech</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820483727.jpg?v=1767770726</image:loc>
      <image:title>Die Waehrungsumrechnung im Rahmen der internationalen Konzernrechnungslegung</image:title>
      <image:caption>Book cover of: Die Waehrungsumrechnung im Rahmen der internationalen Konzernrechnungslegung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wahl-der-vertraege-zwischen-versicherungen-und-kliniken-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631423905</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631423905.jpg?v=1767770727</image:loc>
      <image:title>Die Wahl der Vertraege zwischen Versicherungen und Kliniken</image:title>
      <image:caption>Book cover of: Die Wahl der Vertraege zwischen Versicherungen und Kliniken</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorstellung-vom-schicksal-und-die-darstellung-der-wirklichkeit-in-der-zeitgenoessischen-literatur-islamischer-laender-peter-lang-international-academic-publishers-9783261032898-vortraege-eines-internationalen-symposiums-an-der-universitaet-bern</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261032898.jpg?v=1767770728</image:loc>
      <image:title>Die Vorstellung vom Schicksal und die Darstellung der Wirklichkeit in der zeitgenoessischen Literatur islamischer Laender</image:title>
      <image:caption>Book cover of: Die Vorstellung vom Schicksal und die Darstellung der Wirklichkeit in der zeitgenoessischen Literatur islamischer Laender</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorwegnahme-der-sommer-und-winterschlussverkaeufe-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820496383</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820496383.jpg?v=1767770725</image:loc>
      <image:title>Die Vorwegnahme der Sommer- und Winterschlussverkaeufe</image:title>
      <image:caption>Book cover of: Die Vorwegnahme der Sommer- und Winterschlussverkaeufe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wandlungen-im-grundeigentum-zwischen-1941-und-1965-untersucht-an-einigen-gemeinden-des-kantons-graubuenden-peter-lang-international-academic-publishers-9783261001306-untersucht-an-einigen-gemeinden-des-kantons-graubuenden-rudolf-joller</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorstellung-des-moeglichen-sterbens-einer-nahestehenden-person-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820412147-eine-empirische-untersuchung-einer-psychotherapeutischen-moeglichkeit</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820412147.jpg?v=1767770726</image:loc>
      <image:title>Die Vorstellung des moeglichen Sterbens einer nahestehenden Person</image:title>
      <image:caption>Book cover of: Die Vorstellung des moeglichen Sterbens einer nahestehenden Person</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-i-yale-university-press-9780300071573</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780300071573.jpg?v=1767770730</image:loc>
      <image:title>Edward I</image:title>
      <image:caption>Book cover of: Edward I</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-lloyd-and-his-world-taylor-francis-ltd-9780367206147-popular-fiction-politics-and-the-press-in-victorian-britain-rohan-mcwilliam</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367206147.jpg?v=1767770729</image:loc>
      <image:title>Edward Lloyd and His World</image:title>
      <image:caption>Book cover of: Edward Lloyd and His World. By: Rohan McWilliam</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-i-and-criminal-law-cambridge-university-press-9780521085656-t-f-t-plucknett</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521085656.jpg?v=1767770728</image:loc>
      <image:title>Edward I and Criminal Law</image:title>
      <image:caption>Book cover of: Edward I and Criminal Law. By: T. F. T. Plucknett</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-wachstumsformel-wiley-vch-verlag-gmbh-9783527509232-wie-unternehmen-florieren-statt-einfach-nur-gro-er-zu-werden-oliver-wegner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783527509232.jpg?v=1767770725</image:loc>
      <image:title>Die Wachstumsformel</image:title>
      <image:caption>Book cover of: Die Wachstumsformel. By: Oliver Wegner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-iii-penguin-monarchs-penguin-books-ltd-9780141988672-a-heroic-failure-jonathan-sumption</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780141988672.jpg?v=1767770727</image:loc>
      <image:title>Edward III (Penguin Monarchs)</image:title>
      <image:caption>Book cover of: Edward III (Penguin Monarchs). By: Jonathan Sumption</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorlaeufige-sicherung-raumbedeutsamer-planung-peter-lang-ag-9783631553787-jan-christopher-hennig</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631553787.jpg?v=1767770728</image:loc>
      <image:title>Die Vorlaeufige Sicherung Raumbedeutsamer Planung</image:title>
      <image:caption>Book cover of: Die Vorlaeufige Sicherung Raumbedeutsamer Planung. By: Jan Christopher Hennig</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-lear-and-the-play-of-poetry-oxford-university-press-9780198833796-james-williams</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780198833796.jpg?v=1767770727</image:loc>
      <image:title>Edward Lear and the Play of Poetry</image:title>
      <image:caption>Book cover of: Edward Lear and the Play of Poetry. By: James Williams</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorlaeufige-regelung-mitbestimmungspflichtiger-sozialer-angelegenheiten-im-wege-des-einstweiligen-rechtsschutzes-peter-lang-ag-9783631334157</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631334157.jpg?v=1767770727</image:loc>
      <image:title>Die Vorlaeufige Regelung Mitbestimmungspflichtiger Sozialer Angelegenheiten Im Wege Des Einstweiligen Rechtsschutzes</image:title>
      <image:caption>Book cover of: Die Vorlaeufige Regelung Mitbestimmungspflichtiger Sozialer Angelegenheiten Im Wege Des Einstweiligen Rechtsschutzes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-lear-the-history-press-ltd-9780750937436</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750937436.jpg?v=1767770726</image:loc>
      <image:title>Edward Lear</image:title>
      <image:caption>Book cover of: Edward Lear</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorteilsabschoepfung-im-ordnungswidrigkeitenrecht-in-17-absatz-4-owig-unter-beruecksichtigung-des-deutschen-und-europaeischen-kartellrechts-peter-lang-ag-9783631347584</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631347584.jpg?v=1767770727</image:loc>
      <image:title>Die Vorteilsabschoepfung Im Ordnungswidrigkeitenrecht in 17 Absatz 4 Owig Unter Beruecksichtigung Des Deutschen Und Europaeischen Kartellrechts</image:title>
      <image:caption>Book cover of: Die Vorteilsabschoepfung Im Ordnungswidrigkeitenrecht in 17 Absatz 4 Owig Unter Beruecksichtigung Des Deutschen Und Europaeischen Kartellrechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorlaeufige-weiterbeschaeftigung-gekuendigter-arbeitnehmer-als-gesetzgebungsproblem-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820474084</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820474084.jpg?v=1767770728</image:loc>
      <image:title>Die Vorlaeufige Weiterbeschaeftigung gekuendigter Arbeitnehmer als Gesetzgebungsproblem</image:title>
      <image:caption>Book cover of: Die Vorlaeufige Weiterbeschaeftigung gekuendigter Arbeitnehmer als Gesetzgebungsproblem</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-gorey-colouring-book-pomegranate-communications-inc-us-9780764953460</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780764953460.jpg?v=1767770729</image:loc>
      <image:title>Edward Gorey Colouring Book</image:title>
      <image:caption>Book cover of: Edward Gorey Colouring Book</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorvertragliche-haftung-culpa-in-contrahendo-und-der-deliktsrechtliche-schutz-primaerer-vermoegensinteressen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631433454-rechtsvergleichende-untersuchungen-zum-deutschen-englischen-und-franzo</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631433454.jpg?v=1767770727</image:loc>
      <image:title>Die vorvertragliche Haftung (Culpa in Contrahendo) und der deliktsrechtliche Schutz primaerer Vermoegensinteressen</image:title>
      <image:caption>Book cover of: Die vorvertragliche Haftung (Culpa in Contrahendo) und der deliktsrechtliche Schutz primaerer Vermoegensinteressen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-gorey-dancing-cats-300-piece-jigsaw-puzzle-pomegranate-communications-inc-us-9780764984600</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780764984600.jpg?v=1767770728</image:loc>
      <image:title>Edward Gorey Dancing Cats 300-Piece Jigsaw Puzzle</image:title>
      <image:caption>Book cover of: Edward Gorey Dancing Cats 300-Piece Jigsaw Puzzle</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-hicks-pacifist-bishop-at-war-spck-publishing-9780745956534-the-diaries-of-a-world-war-one-bishop</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780745956534.jpg?v=1767770728</image:loc>
      <image:title>Edward Hicks: Pacifist Bishop at War</image:title>
      <image:caption>Book cover of: Edward Hicks: Pacifist Bishop at War</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-hopper-encyclopedia-mcfarland-co-inc-9780786443567-lenora-mamunes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780786443567.jpg?v=1767770727</image:loc>
      <image:title>Edward Hopper Encyclopedia</image:title>
      <image:caption>Book cover of: Edward Hopper Encyclopedia. By: Lenora Mamunes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorlaeufige-deckungszusage-unter-besonderer-beruecksichtigung-ihrer-handhabung-in-der-lebensversicherung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820402131</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820402131.jpg?v=1767770730</image:loc>
      <image:title>Die vorlaeufige Deckungszusage unter besonderer Beruecksichtigung ihrer Handhabung in der Lebensversicherung</image:title>
      <image:caption>Book cover of: Die vorlaeufige Deckungszusage unter besonderer Beruecksichtigung ihrer Handhabung in der Lebensversicherung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-gorey-s-dracula-a-toy-theatre-pomegranate-communications-inc-us-9780764945410-edward-gorey</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780764945410.jpg?v=1767770731</image:loc>
      <image:title>Edward Gorey&apos;s Dracula a Toy Theatre</image:title>
      <image:caption>Book cover of: Edward Gorey&apos;s Dracula a Toy Theatre. By: Edward Gorey</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-iv-yale-university-press-9780300073720-charles-ross</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780300073720.jpg?v=1767770728</image:loc>
      <image:title>Edward IV</image:title>
      <image:caption>Book cover of: Edward IV. By: Charles Ross</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vor-ag-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631323960-eine-rechtsvergleichende-untersuchung-zwischen-deutschem-und-koreanischem-recht-sung-po-an</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631323960.jpg?v=1767770729</image:loc>
      <image:title>Die Vor-AG</image:title>
      <image:caption>Book cover of: Die Vor-AG. By: Sung-Po An</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-von-praefigierten-verben-abgeleiteten-substantive-in-der-modernen-serbokroatischen-standardsprache-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876901121</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876901121.jpg?v=1767770729</image:loc>
      <image:title>Die von praefigierten Verben abgeleiteten Substantive in der modernen serbokroatischen Standardsprache</image:title>
      <image:caption>Book cover of: Die von praefigierten Verben abgeleiteten Substantive in der modernen serbokroatischen Standardsprache</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorbereitung-der-grundgesetzaenderungen-nach-der-deutschen-wiedervereinigung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631317860-zur-rechtmaeigkeit-von-organisation-und-verfahren-der-gemeinsamen-verfassungskommission</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631317860.jpg?v=1767770729</image:loc>
      <image:title>Die Vorbereitung der Grundgesetzaenderungen nach der deutschen Wiedervereinigung</image:title>
      <image:caption>Book cover of: Die Vorbereitung der Grundgesetzaenderungen nach der deutschen Wiedervereinigung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vor-gmbh-im-zivilprozessualen-erkenntnisverfahren-und-in-der-einzelvollstreckung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631431405</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631431405.jpg?v=1767770728</image:loc>
      <image:title>Die Vor-GmbH im zivilprozessualen Erkenntnisverfahren und in der Einzelvollstreckung</image:title>
      <image:caption>Book cover of: Die Vor-GmbH im zivilprozessualen Erkenntnisverfahren und in der Einzelvollstreckung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-gibbon-and-the-shape-of-history-oxford-university-press-9780198704836-charlotte-roberts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780198704836.jpg?v=1767770729</image:loc>
      <image:title>Edward Gibbon and the Shape of History</image:title>
      <image:caption>Book cover of: Edward Gibbon and the Shape of History. By: Charlotte Roberts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorgeschichte-der-grundung-und-das-erste-jahrzehnt-des-institutes-fur-radiumforschung-springer-vienna-9783709138700-stefan-meyer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783709138700.jpg?v=1767770731</image:loc>
      <image:title>Die Vorgeschichte der Grundung und das erste Jahrzehnt des Institutes fur Radiumforschung</image:title>
      <image:caption>Book cover of: Die Vorgeschichte der Grundung und das erste Jahrzehnt des Institutes fur Radiumforschung. By: Stefan Meyer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vollstreckungskompetenz-nach-35-bverfgg-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631318966-eine-systematische-darstellung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631318966.jpg?v=1767770726</image:loc>
      <image:title>Die Vollstreckungskompetenz nach  35 BVerfGG</image:title>
      <image:caption>Book cover of: Die Vollstreckungskompetenz nach  35 BVerfGG</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vom-verschulden-unabhaengige-haftung-des-arbeitgebers-fuer-arbeitsbedingte-sachschaeden-des-arbeitnehmers-peter-lang-international-academic-publishers-9783261015990</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261015990.jpg?v=1767770730</image:loc>
      <image:title>Die vom Verschulden unabhaengige Haftung des Arbeitgebers fuer arbeitsbedingte Sachschaeden des Arbeitnehmers</image:title>
      <image:caption>Book cover of: Die vom Verschulden unabhaengige Haftung des Arbeitgebers fuer arbeitsbedingte Sachschaeden des Arbeitnehmers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-elgar-modernist-cambridge-university-press-9780521107549-j-p-e-harper-scott</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521107549.jpg?v=1767770728</image:loc>
      <image:title>Edward Elgar, Modernist</image:title>
      <image:caption>Book cover of: Edward Elgar, Modernist. By: J. P. E. Harper-Scott</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-elgar-modernist-cambridge-university-press-9780521862004-j-p-e-harper-scott</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521862004.jpg?v=1767770729</image:loc>
      <image:title>Edward Elgar, Modernist</image:title>
      <image:caption>Book cover of: Edward Elgar, Modernist. By: J. P. E. Harper-Scott</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-gorey-1000-piece-jigsaw-puzzle-pomegranate-communications-inc-us-9780764967733</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780764967733.jpg?v=1767770729</image:loc>
      <image:title>Edward Gorey 1000-Piece Jigsaw Puzzle</image:title>
      <image:caption>Book cover of: Edward Gorey 1000-Piece Jigsaw Puzzle</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-volks-und-fremdenverkehrswirtschaftlichen-auswirkungen-einer-autostrasse-lauterbrunnen-wengen-peter-lang-international-academic-publishers-9783261014375-hans-rentsch</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261014375.jpg?v=1767770730</image:loc>
      <image:title>Die volks- und fremdenverkehrswirtschaftlichen Auswirkungen einer Autostrasse Lauterbrunnen-Wengen</image:title>
      <image:caption>Book cover of: Die volks- und fremdenverkehrswirtschaftlichen Auswirkungen einer Autostrasse Lauterbrunnen-Wengen. By: Hans Rentsch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorbereitung-der-beruflichen-integration-von-schulabgaengern-mit-lernbehinderungen-im-10-schulbesuchsjahr-durch-vorberufliche-bildungsmanahmen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820415506</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820415506.jpg?v=1767770729</image:loc>
      <image:title>Die Vorbereitung der beruflichen Integration von Schulabgaengern mit Lernbehinderungen im 10. Schulbesuchsjahr durch vorberufliche Bildungsmanahmen</image:title>
      <image:caption>Book cover of: Die Vorbereitung der beruflichen Integration von Schulabgaengern mit Lernbehinderungen im 10. Schulbesuchsjahr durch vorberufliche Bildungsmanahmen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorgeschichte-und-die-entstehung-des-mieterschutzgesetzes-von-1923-nebst-der-anordnung-fuer-das-verfahren-vor-dem-mieteinigungsamt-und-der-beschwerdestelle-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631436080</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631436080.jpg?v=1767770731</image:loc>
      <image:title>Die Vorgeschichte und die Entstehung des Mieterschutzgesetzes von 1923 nebst der Anordnung fuer das Verfahren vor dem Mieteinigungsamt und der Beschwerdestelle</image:title>
      <image:caption>Book cover of: Die Vorgeschichte und die Entstehung des Mieterschutzgesetzes von 1923 nebst der Anordnung fuer das Verfahren vor dem Mieteinigungsamt und der Beschwerdestelle</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-iii-the-history-press-ltd-9780752433202-w-m-ormrod</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780752433202.jpg?v=1767770728</image:loc>
      <image:title>Edward III</image:title>
      <image:caption>Book cover of: Edward III. By: W. M. Ormrod</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-elgar-and-his-world-princeton-university-press-9780691134468-byron-adams</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780691134468.jpg?v=1767770731</image:loc>
      <image:title>Edward Elgar and His World</image:title>
      <image:caption>Book cover of: Edward Elgar and His World. By: Byron Adams</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-elgar-and-the-nostalgic-imagination-cambridge-university-press-9780521121835-matthew-riley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521121835.jpg?v=1767770729</image:loc>
      <image:title>Edward Elgar and the Nostalgic Imagination</image:title>
      <image:caption>Book cover of: Edward Elgar and the Nostalgic Imagination. By: Matthew Riley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-gibbon-and-empire-cambridge-university-press-9780521497244</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521497244.jpg?v=1767770730</image:loc>
      <image:title>Edward Gibbon and Empire</image:title>
      <image:caption>Book cover of: Edward Gibbon and Empire</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorgeleistete-beguenstigung-257-258-stgb-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631312834-zugleich-ein-beitrag-zur-kausalitaet-der-beihilfe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631312834.jpg?v=1767770729</image:loc>
      <image:title>Die vorgeleistete Beguenstigung ( 257, 258 StGB)</image:title>
      <image:caption>Book cover of: Die vorgeleistete Beguenstigung ( 257, 258 StGB)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-durell-stone-ww-norton-co-9780393733013-modernism-s-populist-architect-mary-anne-hunting</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780393733013.jpg?v=1767770731</image:loc>
      <image:title>Edward Durell Stone</image:title>
      <image:caption>Book cover of: Edward Durell Stone. By: Mary Anne Hunting</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-carpenter-routledge-revivals-taylor-francis-ltd-9781138017320-in-appreciation-gilbert-beith</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138017320.jpg?v=1767770728</image:loc>
      <image:title>Edward Carpenter (Routledge Revivals)</image:title>
      <image:caption>Book cover of: Edward Carpenter (Routledge Revivals). By: Gilbert Beith</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-voelkerrechtliche-stellung-des-memelgebietes-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631434673</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631434673.jpg?v=1767770729</image:loc>
      <image:title>Die voelkerrechtliche Stellung des Memelgebietes</image:title>
      <image:caption>Book cover of: Die voelkerrechtliche Stellung des Memelgebietes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vollstaendigen-und-unvollstaendigen-familien-im-kindschaftsrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820494082-eine-vergleichende-betrachtung-der-familienrechtlichen-regelungen-in-der-bundesrepublik-deutschland-der-ddr-oester</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820494082.jpg?v=1767770729</image:loc>
      <image:title>Die vollstaendigen und unvollstaendigen Familien im Kindschaftsrecht</image:title>
      <image:caption>Book cover of: Die vollstaendigen und unvollstaendigen Familien im Kindschaftsrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-gibbon-and-empire-cambridge-university-press-9780521525053</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521525053.jpg?v=1767770730</image:loc>
      <image:title>Edward Gibbon and Empire</image:title>
      <image:caption>Book cover of: Edward Gibbon and Empire</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorbereitung-bundeseinheitlicher-gliedstaatlicher-gesetzgebung-in-den-vereinigten-staaten-von-amerika-als-problem-des-kooperativen-foederalismus-peter-lang-international-academic-publishers-9783261026484</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261026484.jpg?v=1767770732</image:loc>
      <image:title>Die Vorbereitung bundeseinheitlicher gliedstaatlicher Gesetzgebung in den Vereinigten Staaten von Amerika als Problem des kooperativen Foederalismus</image:title>
      <image:caption>Book cover of: Die Vorbereitung bundeseinheitlicher gliedstaatlicher Gesetzgebung in den Vereinigten Staaten von Amerika als Problem des kooperativen Foederalismus</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vokaldauer-im-deutschen-als-linguistisches-orthographisches-und-didaktisches-problem-unter-besonderer-beruecksichtigung-des-erlernens-von-deutsch-als-fremdsprache-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631422861</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631422861.jpg?v=1767770731</image:loc>
      <image:title>Die Vokaldauer im Deutschen als linguistisches, orthographisches und didaktisches Problem unter besonderer Beruecksichtigung des Erlernens von Deutsch als Fremdsprache</image:title>
      <image:caption>Book cover of: Die Vokaldauer im Deutschen als linguistisches, orthographisches und didaktisches Problem unter besonderer Beruecksichtigung des Erlernens von Deutsch als Fremdsprache</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vorgaben-des-eckwertes-nr-1-der-gemeinsamen-erklaerung-der-beiden-deutschen-regierungen-vom-15-06-1990-fuer-die-enteignungen-in-den-jahren-1945-1949-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631313794-die-gestaltung-der-gesamtdeuts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631313794.jpg?v=1767770730</image:loc>
      <image:title>Die Vorgaben des Eckwertes Nr. 1 der Gemeinsamen Erklaerung der beiden deutschen Regierungen vom 15.06.1990 fuer die Enteignungen in den Jahren 1945-1949</image:title>
      <image:caption>Book cover of: Die Vorgaben des Eckwertes Nr. 1 der Gemeinsamen Erklaerung der beiden deutschen Regierungen vom 15.06.1990 fuer die Enteignungen in den Jahren 1945-1949</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-elgar-taylor-francis-ltd-9780415875578-a-research-and-information-guide</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415875578.jpg?v=1767770729</image:loc>
      <image:title>Edward Elgar</image:title>
      <image:caption>Book cover of: Edward Elgar</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vokalwechsel-des-polnischen-in-abhaengigkeit-von-flexion-und-derivation-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876903903-eine-generative-beschreibung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876903903.jpg?v=1767770730</image:loc>
      <image:title>Die Vokalwechsel des Polnischen in Abhaengigkeit von Flexion und Derivation</image:title>
      <image:caption>Book cover of: Die Vokalwechsel des Polnischen in Abhaengigkeit von Flexion und Derivation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-curtis-project-talonbooks-9780889226425-a-modern-picture-story-marie-clements</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780889226425.jpg?v=1767770731</image:loc>
      <image:title>Edward Curtis Project</image:title>
      <image:caption>Book cover of: Edward Curtis Project. By: Marie Clements</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-g-robinson-encyclopedia-mcfarland-co-inc-9780786438648-beck-robert</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780786438648.jpg?v=1767770729</image:loc>
      <image:title>Edward G. Robinson Encyclopedia</image:title>
      <image:caption>Book cover of: Edward G. Robinson Encyclopedia. By: Beck, Robert</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-burne-jones-batsford-9780853728832-ann-s-dean</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780853728832.jpg?v=1767770731</image:loc>
      <image:title>Edward Burne-Jones</image:title>
      <image:caption>Book cover of: Edward Burne-Jones. By: Ann S. Dean</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-drummond-libbey-mcfarland-co-inc-9780786463350-a-biography-of-the-american-glassmaker-quentin-r-skrabec</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780786463350.jpg?v=1767770729</image:loc>
      <image:title>Edward Drummond Libbey</image:title>
      <image:caption>Book cover of: Edward Drummond Libbey. By: Quentin R. Skrabec</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vierpersonenkonstellation-im-roman-strukturuntersuchungen-zur-personenfuehrung-peter-lang-international-academic-publishers-9783261002105-dargestellt-an-h-hawthornes-the-blithedale-romance-g-eliots-daniel-deronda-h-james-the-golden-bowl-und-d-h-lawren</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261002105.jpg?v=1767770730</image:loc>
      <image:title>Die Vierpersonenkonstellation im Roman:- Strukturuntersuchungen zur Personenfuehrung</image:title>
      <image:caption>Book cover of: Die Vierpersonenkonstellation im Roman:- Strukturuntersuchungen zur Personenfuehrung. By: Dieter Bareiss</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-volkskorrespondenten-bewegung-der-sed-bezirkspresse-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631454565-theorie-geschichte-und-entwicklung-einer-kommunikatorfigur</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631454565.jpg?v=1767770729</image:loc>
      <image:title>Die Volkskorrespondenten-Bewegung der SED-Bezirkspresse</image:title>
      <image:caption>Book cover of: Die Volkskorrespondenten-Bewegung der SED-Bezirkspresse</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-burtynsky-essential-elements-thames-hudson-ltd-9780500544617-edward-burtynsky</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780500544617.jpg?v=1767770730</image:loc>
      <image:title>Edward Burtynsky: Essential Elements</image:title>
      <image:caption>Book cover of: Edward Burtynsky: Essential Elements. By: Edward Burtynsky</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-burne-jones-the-history-press-ltd-9780750934343-penelope-fitzgerald</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750934343.jpg?v=1767770730</image:loc>
      <image:title>Edward Burne-Jones</image:title>
      <image:caption>Book cover of: Edward Burne-Jones. By: Penelope Fitzgerald</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-voelkerrechtliche-kompetenz-der-vier-maechte-zur-gestaltung-der-rechtslage-deutschlands-nach-dem-abschluss-der-ostvertragspolitik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631404966</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631404966.jpg?v=1767770731</image:loc>
      <image:title>Die voelkerrechtliche Kompetenz der Vier Maechte zur Gestaltung der Rechtslage Deutschlands nach dem Abschluss der Ostvertragspolitik</image:title>
      <image:caption>Book cover of: Die voelkerrechtliche Kompetenz der Vier Maechte zur Gestaltung der Rechtslage Deutschlands nach dem Abschluss der Ostvertragspolitik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-elgar-oxford-university-press-9780198163664-a-creative-life-jerrold-northrop-moore</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780198163664.jpg?v=1767770728</image:loc>
      <image:title>Edward Elgar</image:title>
      <image:caption>Book cover of: Edward Elgar. By: Jerrold Northrop Moore</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vietnampolitik-der-usa-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820463255-von-der-johnson-zur-nixon-kissinger-doktrin-oder-die-neuorientierung-der-amerikanischen-aussenpolitik</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820463255.jpg?v=1767770730</image:loc>
      <image:title>Die Vietnampolitik der USA</image:title>
      <image:caption>Book cover of: Die Vietnampolitik der USA</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-fitzgerald-s-rubaiyat-of-omar-khayyam-anthem-press-9780857287700-a-famous-poem-and-its-influence-w-h-martin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780857287700.jpg?v=1767770731</image:loc>
      <image:title>Edward FitzGerald’s Rubaiyat of Omar Khayyam</image:title>
      <image:caption>Book cover of: Edward FitzGerald’s Rubaiyat of Omar Khayyam. By: W. H. Martin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-carpenter-routledge-revivals-taylor-francis-ltd-9781138015920-in-appreciation-gilbert-beith</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138015920.jpg?v=1767770731</image:loc>
      <image:title>Edward Carpenter (Routledge Revivals)</image:title>
      <image:caption>Book cover of: Edward Carpenter (Routledge Revivals). By: Gilbert Beith</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-albee-cambridge-university-press-9780521726955-a-critical-introduction-matthew-roudan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521726955.jpg?v=1767770731</image:loc>
      <image:title>Edward Albee</image:title>
      <image:caption>Book cover of: Edward Albee. By: Matthew Roudané</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vollzugsdefizite-des-heilmittelwerberechts-und-ihre-privatrechtliche-kompensation-am-beispiel-der-publikumswerbung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631428795</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631428795.jpg?v=1767770731</image:loc>
      <image:title>Die Vollzugsdefizite des Heilmittelwerberechts und ihre privatrechtliche Kompensation am Beispiel der Publikumswerbung</image:title>
      <image:caption>Book cover of: Die Vollzugsdefizite des Heilmittelwerberechts und ihre privatrechtliche Kompensation am Beispiel der Publikumswerbung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-voces8-methode-edition-peters-9790014117597</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9790014117597.jpg?v=1767770734</image:loc>
      <image:title>Die VOCES8 Methode</image:title>
      <image:caption>Book cover of: Die VOCES8 Methode</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwertung-und-die-beseitigung-von-abfaellen-nach-nationalem-recht-und-nach-eg-recht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631361078</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631361078.jpg?v=1767770731</image:loc>
      <image:title>Die Verwertung und die Beseitigung von Abfaellen nach nationalem Recht und nach EG-Recht</image:title>
      <image:caption>Book cover of: Die Verwertung und die Beseitigung von Abfaellen nach nationalem Recht und nach EG-Recht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-bond-letters-3-taylor-francis-ltd-9781138163706-ian-stuart</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138163706.jpg?v=1767770732</image:loc>
      <image:title>Edward Bond: Letters 3</image:title>
      <image:caption>Book cover of: Edward Bond: Letters 3. By: Ian Stuart</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwirklichung-des-verursacherprinzips-in-der-produkt-und-umwelthaftung-landwirtschaftlicher-betriebe-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631325216</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631325216.jpg?v=1767770733</image:loc>
      <image:title>Die Verwirklichung des Verursacherprinzips in der Produkt- und Umwelthaftung landwirtschaftlicher Betriebe</image:title>
      <image:caption>Book cover of: Die Verwirklichung des Verursacherprinzips in der Produkt- und Umwelthaftung landwirtschaftlicher Betriebe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-albee-taylor-francis-inc-9780815331650-a-casebook-bruce-mann</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815331650.jpg?v=1767770731</image:loc>
      <image:title>Edward Albee</image:title>
      <image:caption>Book cover of: Edward Albee. By: Bruce Mann</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwirkung-behoerdlicher-befugnisse-unter-besonderer-beruecksichtigung-des-gefahrenabwehrrechts-peter-lang-ag-9783631347591-rolf-blechschmidt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631347591.jpg?v=1767770731</image:loc>
      <image:title>Die Verwirkung Behoerdlicher Befugnisse Unter Besonderer Beruecksichtigung Des Gefahrenabwehrrechts</image:title>
      <image:caption>Book cover of: Die Verwirkung Behoerdlicher Befugnisse Unter Besonderer Beruecksichtigung Des Gefahrenabwehrrechts. By: Rolf Blechschmidt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-voelkerrechtliche-lage-des-geteilten-zypern-und-fragen-seiner-staatlichen-reorganisation-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631479278</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631479278.jpg?v=1767770731</image:loc>
      <image:title>Die voelkerrechtliche Lage des geteilten Zypern und Fragen seiner staatlichen Reorganisation</image:title>
      <image:caption>Book cover of: Die voelkerrechtliche Lage des geteilten Zypern und Fragen seiner staatlichen Reorganisation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwertbarkeit-von-tagebuchaufzeichnungen-im-strafverfahren-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631489437</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631489437.jpg?v=1767770730</image:loc>
      <image:title>Die Verwertbarkeit von Tagebuchaufzeichnungen im Strafverfahren</image:title>
      <image:caption>Book cover of: Die Verwertbarkeit von Tagebuchaufzeichnungen im Strafverfahren</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-albee-cambridge-university-press-9780521898294-a-critical-introduction-matthew-roudan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521898294.jpg?v=1767770731</image:loc>
      <image:title>Edward Albee</image:title>
      <image:caption>Book cover of: Edward Albee. By: Matthew Roudané</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vielzahl-der-uebersetzungen-und-die-einheit-des-werks-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820493016-bildmuster-und-wortwiederholungen-in-t-s-eliot-collected-poems-gesammelte-gedichte</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820493016.jpg?v=1767770733</image:loc>
      <image:title>Die Vielzahl der Uebersetzungen und die Einheit des Werks</image:title>
      <image:caption>Book cover of: Die Vielzahl der Uebersetzungen und die Einheit des Werks</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwirkung-zivilrechtlicher-rechtspositionen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631478387-die-linie-der-rechtsprechung-bei-der-anwendung-des-verwirkungstatbestandes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631478387.jpg?v=1767770730</image:loc>
      <image:title>Die Verwirkung zivilrechtlicher Rechtspositionen</image:title>
      <image:caption>Book cover of: Die Verwirkung zivilrechtlicher Rechtspositionen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vietnam-generation-und-das-amerikanische-parteiensystem-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820463897-das-wahlverhalten-der-akademischen-jugend-kaliforniens-und-der-usa-in-den-wahlen-1972-und-1974</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820463897.jpg?v=1767770733</image:loc>
      <image:title>Die Vietnam-Generation und das amerikanische Parteiensystem</image:title>
      <image:caption>Book cover of: Die Vietnam-Generation und das amerikanische Parteiensystem</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwertbarkeit-materiell-rechtswidrig-erlangter-beweismittel-im-zivilprozess-peter-lang-international-academic-publishers-9783261025579</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261025579.jpg?v=1767770734</image:loc>
      <image:title>Die Verwertbarkeit materiell-rechtswidrig erlangter Beweismittel im Zivilprozess</image:title>
      <image:caption>Book cover of: Die Verwertbarkeit materiell-rechtswidrig erlangter Beweismittel im Zivilprozess</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educause-leadership-strategies-information-alchemy-john-wiley-sons-inc-9780787950118-the-art-and-science-of-knowledge-management-gerry-bernbom</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780787950118.jpg?v=1767770734</image:loc>
      <image:title>Educause Leadership Strategies, Information Alchemy</image:title>
      <image:caption>Book cover of: Educause Leadership Strategies, Information Alchemy. By: Gerry Bernbom</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwirklichung-der-menschenrechte-im-pakt-der-vereinten-nationen-ueber-buergerliche-und-politische-rechte-vom-16-dezember-1966-im-grundvertrag-und-den-ihn-begleitenden-nebeninstrumenten-peter-lang-international-academic-publishers-9783261017222</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261017222.jpg?v=1767770732</image:loc>
      <image:title>Die Verwirklichung der Menschenrechte im Pakt der Vereinten Nationen ueber buergerliche und politische Rechte vom 16. Dezember 1966, im Grundvertrag und den ihn begleitenden Nebeninstrumenten</image:title>
      <image:caption>Book cover of: Die Verwirklichung der Menschenrechte im Pakt der Vereinten Nationen ueber buergerliche und politische Rechte vom 16. Dezember 1966, im Grundvertrag und den ihn begleitenden Nebeninstrumenten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-albee-s-who-s-afraid-of-virginia-woolf-taylor-francis-ltd-9781138097421-michael-y-bennett</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138097421.jpg?v=1767770730</image:loc>
      <image:title>Edward Albee&apos;s Who&apos;s Afraid of Virginia Woolf?</image:title>
      <image:caption>Book cover of: Edward Albee&apos;s Who&apos;s Afraid of Virginia Woolf?. By: Michael Y. Bennett</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edvard-grieg-and-his-songs-taylor-francis-ltd-9780367343071-sandra-jarrett</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367343071.jpg?v=1767770732</image:loc>
      <image:title>Edvard Grieg and His Songs</image:title>
      <image:caption>Book cover of: Edvard Grieg and His Songs. By: Sandra Jarrett</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educator-s-guide-to-alternative-jobs-careers-impact-publications-9780942710472</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780942710472.jpg?v=1767770732</image:loc>
      <image:title>Educator&apos;s Guide to Alternative Jobs &amp; Careers</image:title>
      <image:caption>Book cover of: Educator&apos;s Guide to Alternative Jobs &amp; Careers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-viermaechteverantwortung-fuer-deutschland-als-ganzes-insbesondere-deren-entwicklung-seit-1969-peter-lang-international-academic-publishers-9783261017123</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261017123.jpg?v=1767770731</image:loc>
      <image:title>Die Viermaechteverantwortung fuer Deutschland als Ganzes, insbesondere deren Entwicklung seit 1969</image:title>
      <image:caption>Book cover of: Die Viermaechteverantwortung fuer Deutschland als Ganzes, insbesondere deren Entwicklung seit 1969</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwertung-von-grundstuecken-durch-den-bund-peter-lang-ag-9783631393925-dargestellt-am-beispiel-der-veraeu-erung-ehemals-militaerisch-genutzter-liegenschaften</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631393925.jpg?v=1767770731</image:loc>
      <image:title>Die Verwertung Von Grundstuecken Durch Den Bund</image:title>
      <image:caption>Book cover of: Die Verwertung Von Grundstuecken Durch Den Bund</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educator-s-guide-to-writing-a-book-taylor-francis-ltd-9781138828940-practical-advice-for-teachers-and-leaders-cathie-e-west</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138828940.jpg?v=1767770734</image:loc>
      <image:title>Educator&apos;s Guide to Writing a Book</image:title>
      <image:caption>Book cover of: Educator&apos;s Guide to Writing a Book. By: Cathie E. West</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwirkung-des-namens-und-unterhaltsrechts-geschiedener-ehegatten-peter-lang-international-academic-publishers-9783261001085-ein-beitrag-zu-den-56-57-und-66-des-ehegesetzes-unter-beruecksichtigung-des-schweizerischen-und-oesterreichischen-rechts-gerha</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261001085.jpg?v=1767770734</image:loc>
      <image:title>Die Verwirkung des Namens- und Unterhaltsrechts geschiedener Ehegatten</image:title>
      <image:caption>Book cover of: Die Verwirkung des Namens- und Unterhaltsrechts geschiedener Ehegatten. By: Gerhart Pötzl</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educause-leadership-strategies-preparing-your-campus-for-a-networked-future-john-wiley-sons-inc-9780787947347-mark-luker</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780787947347.jpg?v=1767770732</image:loc>
      <image:title>Educause Leadership Strategies, Preparing Your Campus for a Networked Future</image:title>
      <image:caption>Book cover of: Educause Leadership Strategies, Preparing Your Campus for a Networked Future. By: Mark Luker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educator-s-guide-to-steam-teachers-college-press-9780807761717-engaging-students-using-real-world-problems-cassie-f-quigley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780807761717.jpg?v=1767770733</image:loc>
      <image:title>Educator&apos;s Guide to STEAM</image:title>
      <image:caption>Book cover of: Educator&apos;s Guide to STEAM. By: Cassie F. Quigley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educator-s-guide-to-substance-abuse-prevention-taylor-francis-inc-9780805825947-sanford-weinstein</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805825947.jpg?v=1767770733</image:loc>
      <image:title>Educator&apos;s Guide To Substance Abuse Prevention</image:title>
      <image:caption>Book cover of: Educator&apos;s Guide To Substance Abuse Prevention. By: Sanford Weinstein</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educator-s-guide-to-solutioning-sage-publications-inc-9780803967496-the-great-things-that-happen-when-you-focus-students-on-solutions-not-problems</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780803967496.jpg?v=1767770731</image:loc>
      <image:title>Educator&apos;s Guide to Solutioning</image:title>
      <image:caption>Book cover of: Educator&apos;s Guide to Solutioning</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vertreter-des-roemischen-rechts-mit-deutscher-unterrichtssprache-an-der-karls-universitaet-in-prag-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631437773-vom-vormaerz-bis-1945</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631437773.jpg?v=1767770733</image:loc>
      <image:title>Die Vertreter des Roemischen Rechts mit deutscher Unterrichtssprache an der Karls-Universitaet in Prag</image:title>
      <image:caption>Book cover of: Die Vertreter des Roemischen Rechts mit deutscher Unterrichtssprache an der Karls-Universitaet in Prag</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edusemiotics-taylor-francis-ltd-9780415727983-semiotic-philosophy-as-educational-foundation-andrew-stables</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415727983.jpg?v=1767770733</image:loc>
      <image:title>Edusemiotics</image:title>
      <image:caption>Book cover of: Edusemiotics. By: Andrew Stables</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educator-s-guide-to-alternative-jobs-careers-impact-publications-9780942710410</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780942710410.jpg?v=1767770733</image:loc>
      <image:title>Educator&apos;s Guide to Alternative Jobs &amp; Careers</image:title>
      <image:caption>Book cover of: Educator&apos;s Guide to Alternative Jobs &amp; Careers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edward-a-wild-and-the-african-brigade-in-the-civil-war-mcfarland-co-inc-9780786424436-frances-h-casstevens</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780786424436.jpg?v=1767770734</image:loc>
      <image:title>Edward A. Wild and the African Brigade in the Civil War</image:title>
      <image:caption>Book cover of: Edward A. Wild and the African Brigade in the Civil War. By: Frances H. Casstevens</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwaltungsbehoerdliche-reformatio-in-peius-und-ihre-prozessuale-problematik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631500002</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631500002.jpg?v=1767770733</image:loc>
      <image:title>Die verwaltungsbehoerdliche «reformatio in peius» und ihre prozessuale Problematik</image:title>
      <image:caption>Book cover of: Die verwaltungsbehoerdliche «reformatio in peius» und ihre prozessuale Problematik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educator-s-guide-to-writing-a-book-taylor-francis-ltd-9781138828957-practical-advice-for-teachers-and-leaders-cathie-e-west</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138828957.jpg?v=1767770734</image:loc>
      <image:title>Educator&apos;s Guide to Writing a Book</image:title>
      <image:caption>Book cover of: Educator&apos;s Guide to Writing a Book. By: Cathie E. West</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edvard-munch-s-mermaid-pennsylvania-state-university-press-9780271028569</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780271028569.jpg?v=1767770732</image:loc>
      <image:title>Edvard Munch&apos;s Mermaid</image:title>
      <image:caption>Book cover of: Edvard Munch&apos;s Mermaid</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vertragsverweigerung-und-ihre-sanktionen-im-franzoesischen-privatrecht-peter-lang-ag-9783631343197-goetz-m-lange</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631343197.jpg?v=1767770730</image:loc>
      <image:title>Die Vertragsverweigerung Und Ihre Sanktionen Im Franzoesischen Privatrecht</image:title>
      <image:caption>Book cover of: Die Vertragsverweigerung Und Ihre Sanktionen Im Franzoesischen Privatrecht. By: Goetz M. Lange</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educations-in-ethnic-violence-cambridge-university-press-9781107602373-identity-educational-bubbles-and-resource-mobilization-matthew-lange</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781107602373.jpg?v=1767770732</image:loc>
      <image:title>Educations in Ethnic Violence</image:title>
      <image:caption>Book cover of: Educations in Ethnic Violence. By: Matthew Lange</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educator-s-book-of-quotes-sage-publications-inc-9780761938620</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761938620.jpg?v=1767770733</image:loc>
      <image:title>Educator&apos;s Book of Quotes</image:title>
      <image:caption>Book cover of: Educator&apos;s Book of Quotes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwaltung-hamburgs-in-der-franzosenzeit-1811-1814-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631405758</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631405758.jpg?v=1767770732</image:loc>
      <image:title>Die Verwaltung Hamburgs in der Franzosenzeit 1811 - 1814</image:title>
      <image:caption>Book cover of: Die Verwaltung Hamburgs in der Franzosenzeit 1811 - 1814</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educator-s-guide-to-humanizing-nursing-education-springer-publishing-co-inc-9780826190086-grounded-in-caring-science-chantal-cara</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780826190086.jpg?v=1767770732</image:loc>
      <image:title>Educator&apos;s Guide to Humanizing Nursing Education</image:title>
      <image:caption>Book cover of: Educator&apos;s Guide to Humanizing Nursing Education. By: Chantal Cara</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vertragsraumordnung-nach-14-abs-2-salzburger-raumordnungsgesetz-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631300985-die-rechtliche-problematik-von-raumordnungsvertraegen-in-oesterreich-dargestellt-anhand-der-salzburger-gesetzeslage</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631300985.jpg?v=1767770733</image:loc>
      <image:title>Die Vertragsraumordnung nach  14 Abs. 2 Salzburger Raumordnungsgesetz</image:title>
      <image:caption>Book cover of: Die Vertragsraumordnung nach  14 Abs. 2 Salzburger Raumordnungsgesetz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vertragspolitik-der-bundesrepublik-deutschland-beim-abschluss-von-doppelbesteuerungsabkommen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820457933</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820457933.jpg?v=1767770731</image:loc>
      <image:title>Die Vertragspolitik der Bundesrepublik Deutschland beim Abschluss von Doppelbesteuerungsabkommen</image:title>
      <image:caption>Book cover of: Die Vertragspolitik der Bundesrepublik Deutschland beim Abschluss von Doppelbesteuerungsabkommen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/edutopia-iuniverse-9780595661145-a-manifesto-for-the-reform-of-public-education-winston-apple</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780595661145.jpg?v=1767770733</image:loc>
      <image:title>Edutopia</image:title>
      <image:caption>Book cover of: Edutopia. By: Winston Apple</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-work-of-women-s-organizations-1890-1960-palgrave-macmillan-9781137366061-anne-meis-knupfer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781137366061.jpg?v=1767770732</image:loc>
      <image:title>Educational Work of Women’s Organizations, 1890–1960</image:title>
      <image:caption>Book cover of: Educational Work of Women’s Organizations, 1890–1960. By: Anne Meis Knupfer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwertbarkeit-heimlicher-privater-ton-und-bildaufnahmen-im-strafverfahren-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631325957</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631325957.jpg?v=1767770731</image:loc>
      <image:title>Die Verwertbarkeit heimlicher privater Ton- und Bildaufnahmen im Strafverfahren</image:title>
      <image:caption>Book cover of: Die Verwertbarkeit heimlicher privater Ton- und Bildaufnahmen im Strafverfahren</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwendungsmoeglichkeit-von-kunstbildern-in-der-psychodiagnostik-am-beispiel-des-persoenlichkeitsmerkmals-vitale-aktivitaet-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820466898</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820466898.jpg?v=1767770734</image:loc>
      <image:title>Die Verwendungsmoeglichkeit von Kunstbildern in der Psychodiagnostik am Beispiel des Persoenlichkeitsmerkmals «Vitale Aktivitaet»</image:title>
      <image:caption>Book cover of: Die Verwendungsmoeglichkeit von Kunstbildern in der Psychodiagnostik am Beispiel des Persoenlichkeitsmerkmals «Vitale Aktivitaet»</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educator-s-book-of-quotes-sage-publications-inc-9780761938637</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761938637.jpg?v=1767770733</image:loc>
      <image:title>Educator&apos;s Book of Quotes</image:title>
      <image:caption>Book cover of: Educator&apos;s Book of Quotes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educative-leadership-taylor-francis-ltd-9780750700597-a-practical-theory-for-new-administrators-and-managers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750700597.jpg?v=1767770735</image:loc>
      <image:title>Educative Leadership</image:title>
      <image:caption>Book cover of: Educative Leadership</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwaltung-zwischen-oeffentlichem-und-privatem-recht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820481181-eroertert-am-beispiel-von-realakt-und-vertrag</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820481181.jpg?v=1767770733</image:loc>
      <image:title>Die Verwaltung zwischen oeffentlichem und privatem Recht</image:title>
      <image:caption>Book cover of: Die Verwaltung zwischen oeffentlichem und privatem Recht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwertbarkeit-des-beweismittels-nach-81-a-stpo-bei-rechtswidriger-beweisgewinnung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631478790</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631478790.jpg?v=1767770731</image:loc>
      <image:title>Die Verwertbarkeit des Beweismittels nach  81 a StPO bei rechtswidriger Beweisgewinnung</image:title>
      <image:caption>Book cover of: Die Verwertbarkeit des Beweismittels nach  81 a StPO bei rechtswidriger Beweisgewinnung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwaltungstreuhand-peter-lang-international-academic-publishers-9783261001115-die-treugeberrechte-bei-insolvenz-des-treuhaenders-konrad-weckerle</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261001115.jpg?v=1767770734</image:loc>
      <image:title>Die Verwaltungstreuhand</image:title>
      <image:caption>Book cover of: Die Verwaltungstreuhand. By: Konrad Weckerle</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-values-and-cognitive-instruction-taylor-francis-ltd-9781138993365-implications-for-reform-lorna-idol</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138993365.jpg?v=1767770732</image:loc>
      <image:title>Educational Values and Cognitive Instruction</image:title>
      <image:caption>Book cover of: Educational Values and Cognitive Instruction. By: Lorna Idol</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vertragsaufhebung-im-haager-einheitlichen-kaufgesetz-peter-lang-international-academic-publishers-9783261021649-system-und-kritik</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261021649.jpg?v=1767770733</image:loc>
      <image:title>Die Vertragsaufhebung im Haager Einheitlichen Kaufgesetz</image:title>
      <image:caption>Book cover of: Die Vertragsaufhebung im Haager Einheitlichen Kaufgesetz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vertragsbeendigung-im-bereich-des-integrierten-vertriebs-als-wettbewerbswidrige-handlung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631459515-ein-vergleich-des-deutschen-mit-dem-franzoesischen-wettbewerbsrecht-unter-beruecksichtigun</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631459515.jpg?v=1767770732</image:loc>
      <image:title>Die Vertragsbeendigung im Bereich des Integrierten Vertriebs als wettbewerbswidrige Handlung</image:title>
      <image:caption>Book cover of: Die Vertragsbeendigung im Bereich des Integrierten Vertriebs als wettbewerbswidrige Handlung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vertragliche-gestaltung-der-beteiligung-an-personen-handelsgesellschaften-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820464436-eine-empirische-untersuchung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820464436.jpg?v=1767770734</image:loc>
      <image:title>Die vertragliche Gestaltung der Beteiligung an Personen-Handelsgesellschaften</image:title>
      <image:caption>Book cover of: Die vertragliche Gestaltung der Beteiligung an Personen-Handelsgesellschaften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-world-of-edward-thring-taylor-francis-ltd-9781138215382-a-centenary-study-donald-leinster-mackay</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138215382.jpg?v=1767770733</image:loc>
      <image:title>Educational World of Edward Thring</image:title>
      <image:caption>Book cover of: Educational World of Edward Thring. By: Donald Leinster-Mackay</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educator-cambridge-university-press-9781108075367-prize-essays-on-the-expediency-and-means-of-elevating-the-profession-of-the-educator-in-society-john-lalor</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781108075367.jpg?v=1767770734</image:loc>
      <image:title>Educator</image:title>
      <image:caption>Book cover of: Educator. By: John Lalor</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-values-and-cognitive-instruction-taylor-francis-inc-9780805803648-implications-for-reform</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805803648.jpg?v=1767770733</image:loc>
      <image:title>Educational Values and Cognitive Instruction</image:title>
      <image:caption>Book cover of: Educational Values and Cognitive Instruction</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vertraege-ueber-zusatz-und-reservestromversorgung-sowie-stromeinspeisung-zwischen-eigenerzeuger-und-gebietsversorgungsunternehmen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631310090</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631310090.jpg?v=1767770734</image:loc>
      <image:title>Die Vertraege ueber Zusatz- und Reservestromversorgung sowie Stromeinspeisung zwischen Eigenerzeuger und Gebietsversorgungsunternehmen</image:title>
      <image:caption>Book cover of: Die Vertraege ueber Zusatz- und Reservestromversorgung sowie Stromeinspeisung zwischen Eigenerzeuger und Gebietsversorgungsunternehmen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verteilung-des-wirtschaftlichen-risikos-der-nothilfe-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631485736-eine-rechtsvergleichende-studie</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631485736.jpg?v=1767770734</image:loc>
      <image:title>Die Verteilung des wirtschaftlichen Risikos der Nothilfe</image:title>
      <image:caption>Book cover of: Die Verteilung des wirtschaftlichen Risikos der Nothilfe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verteilungstheoretische-und-verteilungspolitische-konzeption-der-ig-metall-in-gesamtwirtschaftlicher-sicht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820460261</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820460261.jpg?v=1767770736</image:loc>
      <image:title>Die verteilungstheoretische und verteilungspolitische Konzeption der IG Metall in gesamtwirtschaftlicher Sicht</image:title>
      <image:caption>Book cover of: Die verteilungstheoretische und verteilungspolitische Konzeption der IG Metall in gesamtwirtschaftlicher Sicht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-war-on-poverty-cambridge-university-press-9780521381499-american-and-british-policy-making-1960-1980</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521381499.jpg?v=1767770734</image:loc>
      <image:title>Educational War on Poverty</image:title>
      <image:caption>Book cover of: Educational War on Poverty</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-writings-of-john-locke-cambridge-university-press-9781108010177-john-locke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781108010177.jpg?v=1767770735</image:loc>
      <image:title>Educational Writings of John Locke</image:title>
      <image:caption>Book cover of: Educational Writings of John Locke. By: John Locke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-transactional-analysis-taylor-francis-ltd-9781138832374-an-international-guide-to-theory-and-practice-giles-barrow</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138832374.jpg?v=1767770733</image:loc>
      <image:title>Educational Transactional Analysis</image:title>
      <image:caption>Book cover of: Educational Transactional Analysis. By: Giles Barrow</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-transitions-taylor-francis-ltd-9780415647434-moving-stories-from-around-the-world</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415647434.jpg?v=1767770733</image:loc>
      <image:title>Educational Transitions</image:title>
      <image:caption>Book cover of: Educational Transitions</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-versixte-merkel-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783899755916-nicht-autorisierte-politikerbilder-in-der-kommerziellen-werbung-hannah-zenk</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783899755916.jpg?v=1767770735</image:loc>
      <image:title>Die Versixte Merkel</image:title>
      <image:caption>Book cover of: Die Versixte Merkel. By: Hannah Zenk</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-thought-and-influence-of-matthew-arnold-taylor-francis-ltd-9780415847278-w-f-connell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415847278.jpg?v=1767770733</image:loc>
      <image:title>Educational Thought and Influence of Matthew Arnold</image:title>
      <image:caption>Book cover of: Educational Thought and Influence of Matthew Arnold. By: W. F. Connell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-thought-and-influence-of-matthew-arnold-taylor-francis-ltd-9780415177610-w-f-connell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415177610.jpg?v=1767770734</image:loc>
      <image:title>Educational Thought and Influence of Matthew Arnold</image:title>
      <image:caption>Book cover of: Educational Thought and Influence of Matthew Arnold. By: W.F. Connell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vertrauensmaennerausschuesse-auf-den-preuischen-steinkohlegruben-an-der-saar-entstehung-und-wirken-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631490273-eine-rechtshistorische-untersuchung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631490273.jpg?v=1767770733</image:loc>
      <image:title>Die Vertrauensmaennerausschuesse auf den preuischen Steinkohlegruben an der Saar. Entstehung und Wirken</image:title>
      <image:caption>Book cover of: Die Vertrauensmaennerausschuesse auf den preuischen Steinkohlegruben an der Saar. Entstehung und Wirken</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educatnl-psychol-ussr-ils-268-taylor-francis-ltd-9780415178105-simon-b-j</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415178105.jpg?v=1767770733</image:loc>
      <image:title>Educatnl Psychol Ussr Ils 268</image:title>
      <image:caption>Book cover of: Educatnl Psychol Ussr Ils 268. By: SIMON B&amp;J</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-therapy-in-action-taylor-francis-ltd-9780415888851-behind-and-beyond-the-office-door-dorothy-fink-ungerleider</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415888851.jpg?v=1767770733</image:loc>
      <image:title>Educational Therapy in Action</image:title>
      <image:caption>Book cover of: Educational Therapy in Action. By: Dorothy Fink Ungerleider</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verteilung-der-beweislast-beim-gefahruebergang-nach-un-kaufrecht-peter-lang-ag-9783631326299</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631326299.jpg?v=1767770737</image:loc>
      <image:title>Die Verteilung Der Beweislast Beim Gefahruebergang Nach Un-Kaufrecht</image:title>
      <image:caption>Book cover of: Die Verteilung Der Beweislast Beim Gefahruebergang Nach Un-Kaufrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-versunkene-welt-peter-lang-ag-9783631328132-hannah-arendts-theorie-des-oeffentlichen-handelns</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631328132.jpg?v=1767770735</image:loc>
      <image:title>Die Versunkene Welt</image:title>
      <image:caption>Book cover of: Die Versunkene Welt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-versicherung-von-krediten-als-instrument-kreditspezifischer-risikovorsorge-im-aktivgeschaeft-der-banken-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820453195-eine-theoretische-analyse-der-bilanziellen-auswirkungen-bei-auf-sichtsrecht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820453195.jpg?v=1767770735</image:loc>
      <image:title>Die Versicherung von Krediten als Instrument kreditspezifischer Risikovorsorge im Aktivgeschaeft der Banken</image:title>
      <image:caption>Book cover of: Die Versicherung von Krediten als Instrument kreditspezifischer Risikovorsorge im Aktivgeschaeft der Banken</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-therapy-in-action-taylor-francis-ltd-9780415888844-behind-and-beyond-the-office-door-dorothy-fink-ungerleider</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415888844.jpg?v=1767770735</image:loc>
      <image:title>Educational Therapy in Action</image:title>
      <image:caption>Book cover of: Educational Therapy in Action. By: Dorothy Fink Ungerleider</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-war-on-poverty-cambridge-university-press-9780521025867-american-and-british-policy-making-1960-1980-harold-silver</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521025867.jpg?v=1767770733</image:loc>
      <image:title>Educational War on Poverty</image:title>
      <image:caption>Book cover of: Educational War on Poverty. By: Harold Silver</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verteilung-der-vermoegen-in-der-bundesrepublik-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631355183-analyse-und-politische-schlufolgerungen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631355183.jpg?v=1767770734</image:loc>
      <image:title>Die Verteilung der Vermoegen in der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Verteilung der Vermoegen in der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-transitions-taylor-francis-ltd-9780415805919-moving-stories-from-around-the-world</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415805919.jpg?v=1767770733</image:loc>
      <image:title>Educational Transitions</image:title>
      <image:caption>Book cover of: Educational Transitions</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-transactional-analysis-taylor-francis-ltd-9781138832381-an-international-guide-to-theory-and-practice</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138832381.jpg?v=1767770734</image:loc>
      <image:title>Educational Transactional Analysis</image:title>
      <image:caption>Book cover of: Educational Transactional Analysis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-theory-rle-edu-k-taylor-francis-ltd-9780415751353-an-introduction-terence-w-moore</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415751353.jpg?v=1767770735</image:loc>
      <image:title>Educational Theory (RLE Edu K)</image:title>
      <image:caption>Book cover of: Educational Theory (RLE Edu K). By: Terence W. Moore</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-theory-and-jewish-studies-in-conversation-bloomsbury-publishing-plc-9780739175316-from-volozhin-to-buczacz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780739175316.jpg?v=1767770734</image:loc>
      <image:title>Educational Theory and Jewish Studies in Conversation</image:title>
      <image:caption>Book cover of: Educational Theory and Jewish Studies in Conversation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-versicherte-gefahr-und-der-versicherungsfall-in-der-industrie-straf-rechtsschutzversicherung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631474259</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631474259.jpg?v=1767770737</image:loc>
      <image:title>Die versicherte Gefahr und der Versicherungsfall in der Industrie-Straf-Rechtsschutzversicherung</image:title>
      <image:caption>Book cover of: Die versicherte Gefahr und der Versicherungsfall in der Industrie-Straf-Rechtsschutzversicherung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-theory-and-its-foundation-disciplines-rle-edu-k-taylor-francis-ltd-9780415750899-paul-h-hirst</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415750899.jpg?v=1767770735</image:loc>
      <image:title>Educational Theory and Its Foundation Disciplines (RLE Edu K)</image:title>
      <image:caption>Book cover of: Educational Theory and Its Foundation Disciplines (RLE Edu K). By: Paul H. Hirst</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-theory-rle-edu-k-taylor-francis-ltd-9780415698191-an-introduction-terence-w-moore</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415698191.jpg?v=1767770735</image:loc>
      <image:title>Educational Theory (RLE Edu K)</image:title>
      <image:caption>Book cover of: Educational Theory (RLE Edu K). By: Terence W. Moore</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-theories-cultures-and-learning-taylor-francis-ltd-9780415686501-a-critical-perspective</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415686501.jpg?v=1767770734</image:loc>
      <image:title>Educational Theories, Cultures and Learning</image:title>
      <image:caption>Book cover of: Educational Theories, Cultures and Learning</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verschuldungsbefugnis-der-europaeischen-union-peter-lang-ag-9783631353868</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631353868.jpg?v=1767770736</image:loc>
      <image:title>Die Verschuldungsbefugnis Der Europaeischen Union</image:title>
      <image:caption>Book cover of: Die Verschuldungsbefugnis Der Europaeischen Union</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verwaltungsprozessuale-bedeutung-des-113-abs-3-vwgo-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631328934</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631328934.jpg?v=1767770734</image:loc>
      <image:title>Die verwaltungsprozessuale Bedeutung des  113 Abs. 3 VwGO</image:title>
      <image:caption>Book cover of: Die verwaltungsprozessuale Bedeutung des  113 Abs. 3 VwGO</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-theory-and-its-foundation-disciplines-rle-edu-k-taylor-francis-ltd-9780415689441</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415689441.jpg?v=1767770735</image:loc>
      <image:title>Educational Theory and Its Foundation Disciplines (RLE Edu K)</image:title>
      <image:caption>Book cover of: Educational Theory and Its Foundation Disciplines (RLE Edu K)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-theories-cultures-and-learning-taylor-francis-ltd-9780415491181-a-critical-perspective</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415491181.jpg?v=1767770734</image:loc>
      <image:title>Educational Theories, Cultures and Learning</image:title>
      <image:caption>Book cover of: Educational Theories, Cultures and Learning</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-supervision-in-social-work-columbia-university-press-9780231108539-a-task-centered-model-for-field-instruction-and-staff-development</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780231108539.jpg?v=1767770735</image:loc>
      <image:title>Educational Supervision in Social Work</image:title>
      <image:caption>Book cover of: Educational Supervision in Social Work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-versagung-von-opferentschaedigungsleistungen-gemaess-2-abs-1-oeg-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820411089-zugleich-ein-beitrag-ueber-handhabung-und-bedeutung-von-2-abs-1-oeg-in-der-praxis</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820411089.jpg?v=1767770735</image:loc>
      <image:title>Die Versagung von Opferentschaedigungsleistungen gemaess  2 Abs. 1 OEG</image:title>
      <image:caption>Book cover of: Die Versagung von Opferentschaedigungsleistungen gemaess  2 Abs. 1 OEG</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verschmelzung-einer-kapital-auf-eine-personengesellschaft-nach-dem-neuen-umwstg-unter-beteiligung-beschraenkt-steuerpflichtiger-anteilseigner-peter-lang-ag-9783631351079-edin-hadzic</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631351079.jpg?v=1767770737</image:loc>
      <image:title>Die Verschmelzung Einer Kapital- Auf Eine Personengesellschaft Nach Dem Neuen Umwstg Unter Beteiligung Beschraenkt Steuerpflichtiger Anteilseigner</image:title>
      <image:caption>Book cover of: Die Verschmelzung Einer Kapital- Auf Eine Personengesellschaft Nach Dem Neuen Umwstg Unter Beteiligung Beschraenkt Steuerpflichtiger Anteilseigner. By: Edin Hadzic</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-versicherungswerbung-peter-lang-international-academic-publishers-9783261005809-das-adressmaterial-das-vorbereiten-des-besuches-der-besuch-christian-gasser</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261005809.jpg?v=1767770736</image:loc>
      <image:title>Die Versicherungswerbung</image:title>
      <image:caption>Book cover of: Die Versicherungswerbung. By: Christian Gasser</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verschuldungstaetigkeit-der-europaeischen-gemeinschaften-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631415627-eine-analyse-der-oekonomischen-implikationen-aus-der-sicht-der-staatsschulden-finanzausgleichs-und-integrationsdiskussion</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631415627.jpg?v=1767770736</image:loc>
      <image:title>Die Verschuldungstaetigkeit der Europaeischen Gemeinschaften</image:title>
      <image:caption>Book cover of: Die Verschuldungstaetigkeit der Europaeischen Gemeinschaften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-supervision-in-social-work-columbia-university-press-9780231108522-a-task-centered-model-for-field-instruction-and-staff-development</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780231108522.jpg?v=1767770736</image:loc>
      <image:title>Educational Supervision in Social Work</image:title>
      <image:caption>Book cover of: Educational Supervision in Social Work</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-role-of-the-museum-taylor-francis-ltd-9780415198264-hooper-greenhil</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415198264.jpg?v=1767770735</image:loc>
      <image:title>Educational Role of the Museum</image:title>
      <image:caption>Book cover of: Educational Role of the Museum. By: Hooper-Greenhil</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-resilience-in-inner-city-america-taylor-francis-inc-9780805813241-challenges-and-prospects</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805813241.jpg?v=1767770735</image:loc>
      <image:title>Educational Resilience in inner-city America</image:title>
      <image:caption>Book cover of: Educational Resilience in inner-city America</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-technology-taylor-francis-inc-9780805858617-a-definition-with-commentary-alan-januszewski</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805858617.jpg?v=1767770736</image:loc>
      <image:title>Educational Technology</image:title>
      <image:caption>Book cover of: Educational Technology. By: Alan Januszewski</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-roots-of-political-crisis-in-egypt-bloomsbury-publishing-plc-9780739118986-judith-cochran</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780739118986.jpg?v=1767770735</image:loc>
      <image:title>Educational Roots of Political Crisis in Egypt</image:title>
      <image:caption>Book cover of: Educational Roots of Political Crisis in Egypt. By: Judith Cochran</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-technology-program-and-project-evaluation-taylor-francis-ltd-9781138851412-j-michael-spector</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138851412.jpg?v=1767770737</image:loc>
      <image:title>Educational Technology Program and Project Evaluation</image:title>
      <image:caption>Book cover of: Educational Technology Program and Project Evaluation. By: J. Michael Spector</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verpflichtung-des-abwassereinleiters-zur-weitergabe-von-eigenmewerten-und-der-nemo-tenetur-satz-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631424063</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631424063.jpg?v=1767770737</image:loc>
      <image:title>Die Verpflichtung des Abwassereinleiters zur Weitergabe von Eigenmewerten und der nemo-tenetur-Satz</image:title>
      <image:caption>Book cover of: Die Verpflichtung des Abwassereinleiters zur Weitergabe von Eigenmewerten und der nemo-tenetur-Satz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-service-agency-university-press-of-america-9780761831556-american-education-s-invisible-partner-keane-william-g</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761831556.jpg?v=1767770736</image:loc>
      <image:title>Educational Service Agency</image:title>
      <image:caption>Book cover of: Educational Service Agency. By: Keane William G.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-veroeffentlichung-privater-tatsachen-als-unerlaubte-handlung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631356418-eine-rechtsvergleichende-untersuchung-axel-halfmeier</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631356418.jpg?v=1767770735</image:loc>
      <image:title>Die Veroeffentlichung privater Tatsachen als unerlaubte Handlung</image:title>
      <image:caption>Book cover of: Die Veroeffentlichung privater Tatsachen als unerlaubte Handlung. By: Axel Halfmeier</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verpackungsverordnung-und-ihre-oekologischen-alternativen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631343982-ralf-michael-prufung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631343982.jpg?v=1767770737</image:loc>
      <image:title>Die Verpackungsverordnung und ihre oekologischen Alternativen</image:title>
      <image:caption>Book cover of: Die Verpackungsverordnung und ihre oekologischen Alternativen. By: Ralf Michael Prufung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vernehmung-des-beschuldigten-im-ermittlungsverfahren-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820480252</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820480252.jpg?v=1767770735</image:loc>
      <image:title>Die Vernehmung des Beschuldigten im Ermittlungsverfahren</image:title>
      <image:caption>Book cover of: Die Vernehmung des Beschuldigten im Ermittlungsverfahren</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verschuldensunabhaengige-haftung-analog-906-absatz-2-satz-2-bgb-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631334850</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631334850.jpg?v=1767770735</image:loc>
      <image:title>Die verschuldensunabhaengige Haftung analog  906 Absatz 2 Satz 2 BGB</image:title>
      <image:caption>Book cover of: Die verschuldensunabhaengige Haftung analog  906 Absatz 2 Satz 2 BGB</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verordnungstaetigkeit-der-regierung-insbesondere-deren-kontrolle-durch-das-parlament-mittels-verordnungsvorbehalt-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906750712</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906750712.jpg?v=1767770735</image:loc>
      <image:title>Die Verordnungstaetigkeit der Regierung - insbesondere deren Kontrolle durch das Parlament mittels Verordnungsvorbehalt</image:title>
      <image:caption>Book cover of: Die Verordnungstaetigkeit der Regierung - insbesondere deren Kontrolle durch das Parlament mittels Verordnungsvorbehalt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vermoegensverwaltende-immobilien-kg-mit-genuschein-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631320501-ein-kapitalmarktorientierter-ansatz-zur-loesung-der-bewertungs-und-liquiditaetsproblematik-offener-immobilienfonds-sven-helmer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631320501.jpg?v=1767770735</image:loc>
      <image:title>Die vermoegensverwaltende Immobilien-KG mit Genuschein</image:title>
      <image:caption>Book cover of: Die vermoegensverwaltende Immobilien-KG mit Genuschein. By: Sven Helmer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-role-of-the-museum-taylor-francis-ltd-9780415198271-hooper-greenhil</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415198271.jpg?v=1767770736</image:loc>
      <image:title>Educational Role of the Museum</image:title>
      <image:caption>Book cover of: Educational Role of the Museum. By: Hooper-Greenhil</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-research-policymaking-and-practice-sage-publications-inc-9780761974192</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761974192.jpg?v=1767770735</image:loc>
      <image:title>Educational Research, Policymaking and Practice</image:title>
      <image:caption>Book cover of: Educational Research, Policymaking and Practice</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-technology-program-and-project-evaluation-taylor-francis-ltd-9781138851429-j-michael-spector</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138851429.jpg?v=1767770736</image:loc>
      <image:title>Educational Technology Program and Project Evaluation</image:title>
      <image:caption>Book cover of: Educational Technology Program and Project Evaluation. By: J. Michael Spector</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-research-methodology-and-measurement-emerald-publishing-limited-9780080427102-an-international-handbook</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780080427102.jpg?v=1767770737</image:loc>
      <image:title>Educational Research, Methodology and Measurement</image:title>
      <image:caption>Book cover of: Educational Research, Methodology and Measurement</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-teachings-of-rabbi-menachem-m-schneerson-jason-aronson-publishers-9780765760920-aryeh-solomon</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780765760920.jpg?v=1767770737</image:loc>
      <image:title>Educational Teachings of Rabbi Menachem M. Schneerson</image:title>
      <image:caption>Book cover of: Educational Teachings of Rabbi Menachem M. Schneerson. By: Aryeh Solomon</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-technology-taylor-francis-inc-9780805858600-a-definition-with-commentary-alan-januszewski</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805858600.jpg?v=1767770737</image:loc>
      <image:title>Educational Technology</image:title>
      <image:caption>Book cover of: Educational Technology. By: Alan Januszewski</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-research-for-social-justice-open-university-press-9780335198597</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780335198597.jpg?v=1767770736</image:loc>
      <image:title>Educational Research for Social Justice</image:title>
      <image:caption>Book cover of: Educational Research for Social Justice</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-research-policymaking-and-practice-sage-publications-inc-9780761974208</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761974208.jpg?v=1767770737</image:loc>
      <image:title>Educational Research, Policymaking and Practice</image:title>
      <image:caption>Book cover of: Educational Research, Policymaking and Practice</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verpflichtungen-der-bundesrepublik-im-rahmen-der-nato-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631427651-eine-voelker-und-verfassungsrechtliche-analyse-am-beispiel-der-zustimmung-zur-stationierung-strategischer-nuklearwaffen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631427651.jpg?v=1767770736</image:loc>
      <image:title>Die Verpflichtungen der Bundesrepublik im Rahmen der NATO</image:title>
      <image:caption>Book cover of: Die Verpflichtungen der Bundesrepublik im Rahmen der NATO</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vermoegensverwaltung-deutscher-kreditinstitute-im-privatkundengeschaeft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820400182</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820400182.jpg?v=1767770737</image:loc>
      <image:title>Die Vermoegensverwaltung deutscher Kreditinstitute im Privatkundengeschaeft</image:title>
      <image:caption>Book cover of: Die Vermoegensverwaltung deutscher Kreditinstitute im Privatkundengeschaeft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-research-and-policy-making-taylor-francis-ltd-9780415411745-exploring-the-border-country-between-research-and-policy-lesley-saunders-ed-saunders</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415411745.jpg?v=1767770737</image:loc>
      <image:title>Educational Research and Policy-Making</image:title>
      <image:caption>Book cover of: Educational Research and Policy-Making. By: Lesley Saunders, Ed. Saunders</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vermoegensrechtlichen-beziehungen-der-ehegatten-bei-bestehender-ehe-im-englischen-recht-eigentum-besitz-schuldvertrag-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631317976</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631317976.jpg?v=1767770736</image:loc>
      <image:title>Die vermoegensrechtlichen Beziehungen der Ehegatten bei bestehender Ehe im englischen Recht - Eigentum, Besitz, Schuldvertrag</image:title>
      <image:caption>Book cover of: Die vermoegensrechtlichen Beziehungen der Ehegatten bei bestehender Ehe im englischen Recht - Eigentum, Besitz, Schuldvertrag</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vermoegensuebergabe-gegen-private-versorgungsleistungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631303962</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631303962.jpg?v=1767770737</image:loc>
      <image:title>Die Vermoegensuebergabe gegen private Versorgungsleistungen</image:title>
      <image:caption>Book cover of: Die Vermoegensuebergabe gegen private Versorgungsleistungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-resilience-in-inner-city-america-taylor-francis-inc-9780805813258-challenges-and-prospects</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805813258.jpg?v=1767770736</image:loc>
      <image:title>Educational Resilience in inner-city America</image:title>
      <image:caption>Book cover of: Educational Resilience in inner-city America</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verletzung-des-persoenlichkeitsrechts-durch-bildnisveroeffentlichung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820452181-das-recht-am-eigenen-bild-als-untauglicher-versuch-einer-kon-kretisierung-des-allgemeinen-persoenlichkeitsrech</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820452181.jpg?v=1767770736</image:loc>
      <image:title>Die Verletzung des Persoenlichkeitsrechts durch Bildnisveroeffentlichung</image:title>
      <image:caption>Book cover of: Die Verletzung des Persoenlichkeitsrechts durch Bildnisveroeffentlichung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vermoegensstrafe-gemae-43a-stgb-in-ihrer-kriminalpolitischen-bedeutung-peter-lang-ag-9783631347041-michael-liedke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631347041.jpg?v=1767770737</image:loc>
      <image:title>Die Vermoegensstrafe Gemaeß 43a Stgb in Ihrer Kriminalpolitischen Bedeutung</image:title>
      <image:caption>Book cover of: Die Vermoegensstrafe Gemaeß 43a Stgb in Ihrer Kriminalpolitischen Bedeutung. By: Michael Liedke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verlorene-allmacht-der-feen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820490510-untersuchungen-zum-franzoesischen-kunstmaerchen-des-19-jahrhunderts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820490510.jpg?v=1767770741</image:loc>
      <image:title>Die verlorene Allmacht der Feen</image:title>
      <image:caption>Book cover of: Die verlorene Allmacht der Feen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verlegerische-haftung-auf-unterlassung-fuer-wettbewerbswidrige-anzeigen-in-periodischen-druckwerken-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631478608</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631478608.jpg?v=1767770742</image:loc>
      <image:title>Die verlegerische Haftung auf Unterlassung fuer wettbewerbswidrige Anzeigen in periodischen Druckwerken</image:title>
      <image:caption>Book cover of: Die verlegerische Haftung auf Unterlassung fuer wettbewerbswidrige Anzeigen in periodischen Druckwerken</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vermeidung-internationaler-doppelbesteuerung-von-einkommen-und-konsumorientierte-steuersysteme-peter-lang-ag-9783631521694-branka-loncarevie</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631521694.jpg?v=1767770737</image:loc>
      <image:title>Die Vermeidung Internationaler Doppelbesteuerung Von Einkommen Und Konsumorientierte Steuersysteme</image:title>
      <image:caption>Book cover of: Die Vermeidung Internationaler Doppelbesteuerung Von Einkommen Und Konsumorientierte Steuersysteme. By: Branka Loncarevie</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verkehrspflichthaftung-des-gmbh-geschaeftsfuehrers-peter-lang-ag-9783631347874</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631347874.jpg?v=1767770736</image:loc>
      <image:title>Die Verkehrspflichthaftung Des Gmbh-Geschaeftsfuehrers</image:title>
      <image:caption>Book cover of: Die Verkehrspflichthaftung Des Gmbh-Geschaeftsfuehrers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verklarung-peter-lang-ag-9783631389034-entwicklung-und-bedeutung-eines-institutes-aus-dem-seehandelsrecht-christian-liedtke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631389034.jpg?v=1767770736</image:loc>
      <image:title>Die Verklarung</image:title>
      <image:caption>Book cover of: Die Verklarung. By: Christian Liedtke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verhaengung-und-zumessung-der-jugendstrafe-gemae-17-absatz-2-2-alt-jgg-im-hinblick-auf-das-ihm-zugrundeliegende-antinomieproblem-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631464694</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631464694.jpg?v=1767770737</image:loc>
      <image:title>Die Verhaengung und Zumessung der Jugendstrafe gemae  17 Absatz 2, 2. Alt. JGG im Hinblick auf das ihm zugrundeliegende Antinomieproblem</image:title>
      <image:caption>Book cover of: Die Verhaengung und Zumessung der Jugendstrafe gemae  17 Absatz 2, 2. Alt. JGG im Hinblick auf das ihm zugrundeliegende Antinomieproblem</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reform-in-post-soviet-russia-taylor-francis-ltd-9780714657059-legacies-and-prospects-ben-eklof</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780714657059.jpg?v=1767770738</image:loc>
      <image:title>Educational Reform in Post-Soviet Russia</image:title>
      <image:caption>Book cover of: Educational Reform in Post-Soviet Russia. By: Ben Eklof</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verjaehrungsproblematik-der-vertraglichen-haftung-des-rechtsanwaltes-und-des-steuerberaters-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631447079-51-brao-68-stberg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631447079.jpg?v=1767770736</image:loc>
      <image:title>Die Verjaehrungsproblematik der vertraglichen Haftung des Rechtsanwaltes und des Steuerberaters</image:title>
      <image:caption>Book cover of: Die Verjaehrungsproblematik der vertraglichen Haftung des Rechtsanwaltes und des Steuerberaters</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-research-and-policy-making-taylor-francis-ltd-9780415411752-exploring-the-border-country-between-research-and-policy-lesley-saunders-ed-saunders</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415411752.jpg?v=1767770737</image:loc>
      <image:title>Educational Research and Policy-Making</image:title>
      <image:caption>Book cover of: Educational Research and Policy-Making. By: Lesley Saunders, Ed. Saunders</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verschuldung-der-dritten-welt-1970-1983-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820412017-entwicklung-und-ursachen-der-krise-in-den-finanzbeziehungen-zwischen-norden-und-sueden</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820412017.jpg?v=1767770742</image:loc>
      <image:title>Die Verschuldung der Dritten Welt 1970-1983</image:title>
      <image:caption>Book cover of: Die Verschuldung der Dritten Welt 1970-1983</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vergutung-des-sachverstandigen-vieweg-teubner-verlag-9783322998057-grundlagen-jveg-zseg-beispiele-andreas-weglage</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783322998057.jpg?v=1767770737</image:loc>
      <image:title>Die Vergutung des Sachverstandigen</image:title>
      <image:caption>Book cover of: Die Vergutung des Sachverstandigen. By: Andreas Weglage</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vermarktung-landwirtschaftlicher-produkte-in-ausgewaehlten-regionen-ecuadors-und-boliviens-peter-lang-international-academic-publishers-9783261025395-ein-beitrag-zur-beurteilung-landwirtschaftlicher-vermarktungssysteme-als-faktor-sozialoekonomischer-u</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261025395.jpg?v=1767770737</image:loc>
      <image:title>Die Vermarktung landwirtschaftlicher Produkte in ausgewaehlten Regionen Ecuadors und Boliviens</image:title>
      <image:caption>Book cover of: Die Vermarktung landwirtschaftlicher Produkte in ausgewaehlten Regionen Ecuadors und Boliviens</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verlustrueckstellung-im-steuer-und-verfassungsrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631347966-michael-r-wiesbrock</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631347966.jpg?v=1767770737</image:loc>
      <image:title>Die Verlustrueckstellung im Steuer- und Verfassungsrecht</image:title>
      <image:caption>Book cover of: Die Verlustrueckstellung im Steuer- und Verfassungsrecht. By: Michael R. Wiesbrock</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reform-taylor-francis-ltd-9780415750868-the-task-of-the-board-of-education-fabian-ware</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415750868.jpg?v=1767770738</image:loc>
      <image:title>Educational Reform</image:title>
      <image:caption>Book cover of: Educational Reform. By: Fabian Ware</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verhexte-speise-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631466469-eine-ethnopsychosomatische-studie-ueber-das-depressive-syndrom-in-nepal</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631466469.jpg?v=1767770740</image:loc>
      <image:title>Die verhexte Speise</image:title>
      <image:caption>Book cover of: Die verhexte Speise</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verguetung-von-vorstandsmitgliedern-in-publikumsaktiengesellschaften-peter-lang-ag-9783631335352-eine-vergleichende-untersuchung-zum-deutschen-englischen-und-us-amerikanischen-recht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631335352.jpg?v=1767770737</image:loc>
      <image:title>Die Verguetung Von Vorstandsmitgliedern in Publikumsaktiengesellschaften</image:title>
      <image:caption>Book cover of: Die Verguetung Von Vorstandsmitgliedern in Publikumsaktiengesellschaften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reform-in-post-soviet-russia-taylor-francis-ltd-9780415649186-legacies-and-prospects</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415649186.jpg?v=1767770737</image:loc>
      <image:title>Educational Reform in Post-Soviet Russia</image:title>
      <image:caption>Book cover of: Educational Reform in Post-Soviet Russia</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-research-john-wiley-sons-inc-9780470139103-james-schreiber</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780470139103.jpg?v=1767770737</image:loc>
      <image:title>Educational Research</image:title>
      <image:caption>Book cover of: Educational Research. By: James Schreiber</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reconstruction-fordham-university-press-9780823270118-african-american-schools-in-the-urban-south-1865-1890-hilary-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780823270118.jpg?v=1767770737</image:loc>
      <image:title>Educational Reconstruction</image:title>
      <image:caption>Book cover of: Educational Reconstruction. By: Hilary Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reconstruction-taylor-francis-ltd-9780713001914-the-1944-education-act-and-the-twenty-first-century</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780713001914.jpg?v=1767770738</image:loc>
      <image:title>Educational Reconstruction</image:title>
      <image:caption>Book cover of: Educational Reconstruction</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-research-taylor-francis-inc-9780805832808-a-guide-to-the-process-norman-e-wallen-norman-e-wallen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805832808.jpg?v=1767770737</image:loc>
      <image:title>Educational Research</image:title>
      <image:caption>Book cover of: Educational Research. By: Norman E. Wallen, Norman E Wallen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reform-and-environmental-concern-taylor-francis-ltd-9780367202194-a-history-of-school-nature-study-in-australia-dorothy-kass</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367202194.jpg?v=1767770738</image:loc>
      <image:title>Educational Reform and Environmental Concern</image:title>
      <image:caption>Book cover of: Educational Reform and Environmental Concern. By: Dorothy Kass</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reform-taylor-francis-ltd-9780415689274-the-task-of-the-board-of-education-fabian-ware</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415689274.jpg?v=1767770737</image:loc>
      <image:title>Educational Reform</image:title>
      <image:caption>Book cover of: Educational Reform. By: Fabian Ware</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reconstruction-taylor-francis-ltd-9780713040197-the-1944-education-act-and-the-twenty-first-century</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780713040197.jpg?v=1767770739</image:loc>
      <image:title>Educational Reconstruction</image:title>
      <image:caption>Book cover of: Educational Reconstruction</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-qualitative-research-in-latin-america-taylor-francis-inc-9780815313533-the-struggle-for-a-new-paradigm</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815313533.jpg?v=1767770737</image:loc>
      <image:title>Educational Qualitative Research in Latin America</image:title>
      <image:caption>Book cover of: Educational Qualitative Research in Latin America</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reform-at-the-state-level-the-politics-and-problems-of-implementation-taylor-francis-ltd-9780750702065</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750702065.jpg?v=1767770738</image:loc>
      <image:title>Educational Reform At The State Level: The Politics And Problems Of implementation</image:title>
      <image:caption>Book cover of: Educational Reform At The State Level: The Politics And Problems Of implementation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reform-at-the-state-level-the-politics-and-problems-of-implementation-taylor-francis-ltd-9781138968424-jean-madsen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138968424.jpg?v=1767770737</image:loc>
      <image:title>Educational Reform At The State Level: The Politics And Problems Of implementation</image:title>
      <image:caption>Book cover of: Educational Reform At The State Level: The Politics And Problems Of implementation. By: Jean Madsen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reform-taylor-francis-inc-9780815320890-a-deweyan-perspective</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815320890.jpg?v=1767770736</image:loc>
      <image:title>Educational Reform</image:title>
      <image:caption>Book cover of: Educational Reform</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfemte-in-der-literatur-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631457207-zur-darstellung-der-dirne-in-der-erzaehlkunst-des-19-und-20-jahrhunderts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631457207.jpg?v=1767770738</image:loc>
      <image:title>Die Verfemte in der Literatur</image:title>
      <image:caption>Book cover of: Die Verfemte in der Literatur</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verhaeltnismae-igkeit-des-dopingkontrollsystems-peter-lang-ag-9783631392836</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631392836.jpg?v=1767770737</image:loc>
      <image:title>Die Verhaeltnismaeßigkeit Des Dopingkontrollsystems</image:title>
      <image:caption>Book cover of: Die Verhaeltnismaeßigkeit Des Dopingkontrollsystems</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verjaehrung-erbrechtlicher-ansprueche-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783899755282-eine-auseinandersetzung-mit-der-norm-des-197-abs-1-nr-2-2-alt-bgb-felix-baum</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783899755282.jpg?v=1767770740</image:loc>
      <image:title>Die Verjaehrung Erbrechtlicher Ansprueche</image:title>
      <image:caption>Book cover of: Die Verjaehrung Erbrechtlicher Ansprueche. By: Felix Baum</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verguetung-des-aufsichtsrats-in-abhaengigkeit-vom-aktienkurs-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631359105</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631359105.jpg?v=1767770738</image:loc>
      <image:title>Die Verguetung des Aufsichtsrats in Abhaengigkeit vom Aktienkurs</image:title>
      <image:caption>Book cover of: Die Verguetung des Aufsichtsrats in Abhaengigkeit vom Aktienkurs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reciprocity-and-adaptivity-taylor-francis-ltd-9780367371371-international-students-and-stakeholders-ibrahim-wade-ata</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367371371.jpg?v=1767770737</image:loc>
      <image:title>Educational Reciprocity and Adaptivity</image:title>
      <image:caption>Book cover of: Educational Reciprocity and Adaptivity. By: Ibrahim Wade Ata</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-qualitative-research-in-latin-america-taylor-francis-ltd-9781138993310-the-struggle-for-a-new-paradigm-anderson-gary-l</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138993310.jpg?v=1767770739</image:loc>
      <image:title>Educational Qualitative Research in Latin America</image:title>
      <image:caption>Book cover of: Educational Qualitative Research in Latin America. By: Anderson, Gary L.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vergabe-von-wirtschaftssubventionen-und-strafrechtliche-verantwortlichkeit-gem-264-stgb-subventionsbetrug-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631475034</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631475034.jpg?v=1767770737</image:loc>
      <image:title>Die Vergabe von Wirtschaftssubventionen und strafrechtliche Verantwortlichkeit gem.  264 StGB (Subventionsbetrug)</image:title>
      <image:caption>Book cover of: Die Vergabe von Wirtschaftssubventionen und strafrechtliche Verantwortlichkeit gem.  264 StGB (Subventionsbetrug)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-concepts-research-and-challenges-taylor-francis-ltd-9780415562638-christine-m-rubie-davies</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415562638.jpg?v=1767770739</image:loc>
      <image:title>Educational Psychology: Concepts, Research and Challenges</image:title>
      <image:caption>Book cover of: Educational Psychology: Concepts, Research and Challenges. By: Christine M. Rubie-Davies</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsrechtliche-aufgabenverteilung-zwischen-gemeinden-und-landkreisen-insbesondere-nach-bayerischem-verfassungsrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631457894</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631457894.jpg?v=1767770740</image:loc>
      <image:title>Die verfassungsrechtliche Aufgabenverteilung zwischen Gemeinden und Landkreisen insbesondere nach bayerischem Verfassungsrecht</image:title>
      <image:caption>Book cover of: Die verfassungsrechtliche Aufgabenverteilung zwischen Gemeinden und Landkreisen insbesondere nach bayerischem Verfassungsrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsgerichtliche-unvereinbarerklaerung-verfassungswidriger-gesetze-peter-lang-ag-9783631334324-untersuchungen-zur-entwicklung-und-funktion-dieser-rechtsfigur-im-deutschen-recht-und-zu-ihrer-uebertragbarkeit-ins-costaricanische-recht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631334324.jpg?v=1767770739</image:loc>
      <image:title>Die Verfassungsgerichtliche Unvereinbarerklaerung Verfassungswidriger Gesetze</image:title>
      <image:caption>Book cover of: Die Verfassungsgerichtliche Unvereinbarerklaerung Verfassungswidriger Gesetze</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verhaeltnismaeigkeit-nachtraeglicher-anordnungen-nach-17-bundes-immissionsschutzgesetz-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631427637</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631427637.jpg?v=1767770741</image:loc>
      <image:title>Die Verhaeltnismaeigkeit nachtraeglicher Anordnungen nach  17 Bundes-Immissionsschutzgesetz</image:title>
      <image:caption>Book cover of: Die Verhaeltnismaeigkeit nachtraeglicher Anordnungen nach  17 Bundes-Immissionsschutzgesetz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-concepts-research-and-challenges-taylor-francis-ltd-9780415562645-christine-m-rubie-davies</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415562645.jpg?v=1767770741</image:loc>
      <image:title>Educational Psychology: Concepts, Research and Challenges</image:title>
      <image:caption>Book cover of: Educational Psychology: Concepts, Research and Challenges. By: Christine M. Rubie-Davies</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsrechtliche-problematik-der-gesamtstaatlichen-kunst-und-kulturpflege-in-der-bundesrepublik-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631428139</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631428139.jpg?v=1767770740</image:loc>
      <image:title>Die verfassungsrechtliche Problematik der gesamtstaatlichen Kunst- und Kulturpflege in der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die verfassungsrechtliche Problematik der gesamtstaatlichen Kunst- und Kulturpflege in der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-and-the-internet-cambridge-university-press-9781107095441-michael-glassman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781107095441.jpg?v=1767770740</image:loc>
      <image:title>Educational Psychology and the Internet</image:title>
      <image:caption>Book cover of: Educational Psychology and the Internet. By: Michael Glassman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsrechtlichen-grenzen-fuer-die-gesetzliche-einfuehrung-einer-verwaltungssektion-bei-medizinisch-unklaren-todesfaellen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631354049</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631354049.jpg?v=1767770739</image:loc>
      <image:title>Die verfassungsrechtlichen Grenzen fuer die gesetzliche Einfuehrung einer «Verwaltungssektion» bei medizinisch unklaren Todesfaellen</image:title>
      <image:caption>Book cover of: Die verfassungsrechtlichen Grenzen fuer die gesetzliche Einfuehrung einer «Verwaltungssektion» bei medizinisch unklaren Todesfaellen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verguetung-fuer-die-ueberspielung-zum-privaten-gebrauch-gemae-54-absatz-1-urhg-und-ihre-verteilung-unter-die-berechtigten-im-filmbereich-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631459331</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631459331.jpg?v=1767770744</image:loc>
      <image:title>Die Verguetung fuer die Ueberspielung zum privaten Gebrauch gemae  54 Absatz 1 UrhG und ihre Verteilung unter die Berechtigten im Filmbereich</image:title>
      <image:caption>Book cover of: Die Verguetung fuer die Ueberspielung zum privaten Gebrauch gemae  54 Absatz 1 UrhG und ihre Verteilung unter die Berechtigten im Filmbereich</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reform-taylor-francis-inc-9780815323235-a-deweyan-perspective</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815323235.jpg?v=1767770741</image:loc>
      <image:title>Educational Reform</image:title>
      <image:caption>Book cover of: Educational Reform</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-and-the-internet-cambridge-university-press-9781107479302-michael-glassman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781107479302.jpg?v=1767770740</image:loc>
      <image:title>Educational Psychology and the Internet</image:title>
      <image:caption>Book cover of: Educational Psychology and the Internet. By: Michael Glassman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungswidrigerklaerung-von-gesetzen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820465471-eine-untersuchung-der-voraussetzungen-und-folgen-des-verzichts-auf-die-gesetzestechnisch-moegliche-nichtigerklaerung-durch-das-bundesverfa</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820465471.jpg?v=1767770741</image:loc>
      <image:title>Die Verfassungswidrigerklaerung von Gesetzen</image:title>
      <image:caption>Book cover of: Die Verfassungswidrigerklaerung von Gesetzen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsrechtliche-begruendung-der-progressiven-einkommensteuer-und-ihre-systemgerechte-durchfuehrung-peter-lang-international-academic-publishers-9783261014054</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261014054.jpg?v=1767770740</image:loc>
      <image:title>Die Verfassungsrechtliche Begruendung der progressiven Einkommensteuer und ihre systemgerechte Durchfuehrung</image:title>
      <image:caption>Book cover of: Die Verfassungsrechtliche Begruendung der progressiven Einkommensteuer und ihre systemgerechte Durchfuehrung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-taylor-francis-ltd-9780415679961-charles-hubbard-judd</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415679961.jpg?v=1767770740</image:loc>
      <image:title>Educational Psychology</image:title>
      <image:caption>Book cover of: Educational Psychology. By: Charles Hubbard Judd</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vergabe-von-slots-peter-lang-ag-9783631587621-vorschlaege-zur-aenderung-bestehender-vergabesysteme-philipp-weiner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631587621.jpg?v=1767770741</image:loc>
      <image:title>Die Vergabe Von Slots</image:title>
      <image:caption>Book cover of: Die Vergabe Von Slots. By: Philipp Weiner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsmae-igkeit-von-landeskinderklauseln-peter-lang-ag-9783631329214-eine-untersuchung-zu-art-33-abs-1-gg-unter-besonderer-beruecksichtigung-der-verfassungshistorischen-entwicklung-und-veranschaulicht-an-anwendungsbeispielen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631329214.jpg?v=1767770739</image:loc>
      <image:title>Die Verfassungsmaeßigkeit Von Landeskinderklauseln</image:title>
      <image:caption>Book cover of: Die Verfassungsmaeßigkeit Von Landeskinderklauseln</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-taylor-francis-ltd-9781138875111-its-problems-and-methods-fox-charles-charles</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138875111.jpg?v=1767770743</image:loc>
      <image:title>Educational Psychology</image:title>
      <image:caption>Book cover of: Educational Psychology. By: Fox, Charles, Charles</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfahrensrechtliche-bedeutung-polizeilicher-vorfeldermittlungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631337011-zugleich-eine-studie-zur-rechtsstellung-des-von-vorfeldermittlungen-betroffenen-personenkreises</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631337011.jpg?v=1767770744</image:loc>
      <image:title>Die verfahrensrechtliche Bedeutung polizeilicher Vorfeldermittlungen</image:title>
      <image:caption>Book cover of: Die verfahrensrechtliche Bedeutung polizeilicher Vorfeldermittlungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsrechtliche-filmfreiheit-und-ihre-grenzen-filmzensur-und-filmfoerderung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820454819-filmzensur-und-filmfoerderung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820454819.jpg?v=1767770740</image:loc>
      <image:title>Die verfassungsrechtliche Filmfreiheit und ihre Grenzen- Filmzensur und Filmfoerderung</image:title>
      <image:caption>Book cover of: Die verfassungsrechtliche Filmfreiheit und ihre Grenzen- Filmzensur und Filmfoerderung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-taylor-francis-ltd-9780415209885-its-problems-and-methods-charles-fox</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415209885.jpg?v=1767770742</image:loc>
      <image:title>Educational Psychology</image:title>
      <image:caption>Book cover of: Educational Psychology. By: Charles Fox</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-taylor-francis-inc-9780805836813-a-century-of-contributions-a-project-of-division-15-educational-psychology-of-the-american-psychological-society</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805836813.jpg?v=1767770740</image:loc>
      <image:title>Educational Psychology</image:title>
      <image:caption>Book cover of: Educational Psychology</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfahrensrechtliche-kontrolle-unfairer-allgemeiner-geschaeftsbedingungen-in-england-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631325896-zur-praktischen-wirksamkeit-von-agb-kontrollverfahren-im-vergleich-zum-deutschen-recht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631325896.jpg?v=1767770741</image:loc>
      <image:title>Die verfahrensrechtliche Kontrolle «unfairer» Allgemeiner Geschaeftsbedingungen in England</image:title>
      <image:caption>Book cover of: Die verfahrensrechtliche Kontrolle «unfairer» Allgemeiner Geschaeftsbedingungen in England</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfahren-der-textbildung-in-j-r-r-tolkiens-the-hobbit-peter-lang-international-academic-publishers-9783261033505</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261033505.jpg?v=1767770744</image:loc>
      <image:title>Die Verfahren der Textbildung in J.R.R. Tolkiens the Hobbit</image:title>
      <image:caption>Book cover of: Die Verfahren der Textbildung in J.R.R. Tolkiens the Hobbit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-pearson-education-us-9780205626076-robert-j-sternberg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780205626076.jpg?v=1767770742</image:loc>
      <image:title>Educational Psychology</image:title>
      <image:caption>Book cover of: Educational Psychology. By: Robert J. Sternberg</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsrechtliche-zulaessigkeit-der-beleihung-einer-aktiengesellschaft-mit-dienstherrenbefugnissen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631488256-dargestellt-am-beispiel-der-deutschen-post-ag-deutschen-postbank-ag-deutsche</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631488256.jpg?v=1767770745</image:loc>
      <image:title>Die verfassungsrechtliche Zulaessigkeit der Beleihung einer Aktiengesellschaft mit Dienstherrenbefugnissen</image:title>
      <image:caption>Book cover of: Die verfassungsrechtliche Zulaessigkeit der Beleihung einer Aktiengesellschaft mit Dienstherrenbefugnissen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-taylor-francis-inc-9780805897067-yesterday-today-and-tomorrow-a-special-issue-of-educational-psychologist</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805897067.jpg?v=1767770743</image:loc>
      <image:title>Educational Psychology</image:title>
      <image:caption>Book cover of: Educational Psychology</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsgerichtliche-normenkontrolle-durch-den-conseil-constitutionnel-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631356135-zum-kompetenztitel-des-art-61-der-franzoesischen-verfassung-jochen-starke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631356135.jpg?v=1767770742</image:loc>
      <image:title>Die verfassungsgerichtliche Normenkontrolle durch den Conseil constitutionnel</image:title>
      <image:caption>Book cover of: Die verfassungsgerichtliche Normenkontrolle durch den Conseil constitutionnel. By: Jochen Starke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfahrensstandschaft-fuer-die-stationierungsstreitkraefte-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631487785-zur-rechtslage-bei-liegenschaftsnutzungen-der-auslaendischen-nato-truppen-in-der-bundesrepublik-deutschland-die-nach-deu</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631487785.jpg?v=1767770742</image:loc>
      <image:title>Die Verfahrensstandschaft fuer die Stationierungsstreitkraefte</image:title>
      <image:caption>Book cover of: Die Verfahrensstandschaft fuer die Stationierungsstreitkraefte</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-reconstruction-fordham-university-press-9780823270125-african-american-schools-in-the-urban-south-1865-1890-hilary-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780823270125.jpg?v=1767770740</image:loc>
      <image:title>Educational Reconstruction</image:title>
      <image:caption>Book cover of: Educational Reconstruction. By: Hilary Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vereinzelung-des-individuums-und-perspektiven-ihrer-paedagogischen-ueberwindung-aus-der-sicht-der-kritischen-theorie-peter-lang-international-academic-publishers-9783261043245-martin-ludwig</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261043245.jpg?v=1767770740</image:loc>
      <image:title>Die Vereinzelung des Individuums und Perspektiven ihrer paedagogischen Ueberwindung aus der Sicht der Kritischen Theorie</image:title>
      <image:caption>Book cover of: Die Vereinzelung des Individuums und Perspektiven ihrer paedagogischen Ueberwindung aus der Sicht der Kritischen Theorie. By: Martin Ludwig</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-progressivism-cultural-encounters-and-reform-in-japan-taylor-francis-ltd-9780367133917-yoko-yamasaki</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367133917.jpg?v=1767770742</image:loc>
      <image:title>Educational Progressivism, Cultural Encounters and Reform in Japan</image:title>
      <image:caption>Book cover of: Educational Progressivism, Cultural Encounters and Reform in Japan. By: Yoko Yamasaki</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-provision-for-children-with-autism-and-asperger-syndrome-taylor-francis-ltd-9781138153400-meeting-their-needs-glenys-jones</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138153400.jpg?v=1767770742</image:loc>
      <image:title>Educational Provision for Children with Autism and Asperger Syndrome</image:title>
      <image:caption>Book cover of: Educational Provision for Children with Autism and Asperger Syndrome. By: Glenys Jones</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsbindung-des-gesetzgebers-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631432853-untersucht-am-problem-der-redimensionierung-des-sozialstaates-in-den-jahren-1975-1985</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631432853.jpg?v=1767770743</image:loc>
      <image:title>Die Verfassungsbindung des Gesetzgebers</image:title>
      <image:caption>Book cover of: Die Verfassungsbindung des Gesetzgebers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-taylor-francis-inc-9780805836820-a-century-of-contributions-a-project-of-division-15-educational-psychology-of-the-american-psychological-society</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805836820.jpg?v=1767770743</image:loc>
      <image:title>Educational Psychology</image:title>
      <image:caption>Book cover of: Educational Psychology</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsgebende-gewalt-des-volkes-unter-besonderer-beruecksichtigung-des-deutschen-und-chilenischen-grundgesetzes-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631482070</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631482070.jpg?v=1767770743</image:loc>
      <image:title>Die verfassungsgebende Gewalt des Volkes unter besonderer Beruecksichtigung des deutschen und chilenischen Grundgesetzes</image:title>
      <image:caption>Book cover of: Die verfassungsgebende Gewalt des Volkes unter besonderer Beruecksichtigung des deutschen und chilenischen Grundgesetzes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-progressivism-cultural-encounters-and-reform-in-japan-taylor-francis-ltd-9781138955639-yoko-yamasaki</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138955639.jpg?v=1767770744</image:loc>
      <image:title>Educational Progressivism, Cultural Encounters and Reform in Japan</image:title>
      <image:caption>Book cover of: Educational Progressivism, Cultural Encounters and Reform in Japan. By: Yoko Yamasaki</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-potential-of-e-portfolios-taylor-francis-ltd-9780415412148-supporting-personal-development-and-reflective-learning-stefani-mason-p</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415412148.jpg?v=1767770740</image:loc>
      <image:title>Educational Potential of e-Portfolios</image:title>
      <image:caption>Book cover of: Educational Potential of e-Portfolios. By: Stefani/Mason/P</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vererbung-von-anteilen-deutscher-personengesellschaften-im-internationalen-privatrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631457795</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631457795.jpg?v=1767770742</image:loc>
      <image:title>Die Vererbung von Anteilen deutscher Personengesellschaften im Internationalen Privatrecht</image:title>
      <image:caption>Book cover of: Die Vererbung von Anteilen deutscher Personengesellschaften im Internationalen Privatrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-policy-and-the-politics-of-change-taylor-francis-ltd-9780415118705</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415118705.jpg?v=1767770740</image:loc>
      <image:title>Educational Policy and the Politics of Change</image:title>
      <image:caption>Book cover of: Educational Policy and the Politics of Change</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsdiskussion-motive-ziele-perspektiven-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631452615</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631452615.jpg?v=1767770744</image:loc>
      <image:title>Die Verfassungsdiskussion: Motive, Ziele, Perspektiven</image:title>
      <image:caption>Book cover of: Die Verfassungsdiskussion: Motive, Ziele, Perspektiven</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-taylor-francis-ltd-9781138006324-charles-hubbard-judd</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138006324.jpg?v=1767770742</image:loc>
      <image:title>Educational Psychology</image:title>
      <image:caption>Book cover of: Educational Psychology. By: Charles Hubbard Judd</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsentwicklung-in-namibia-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631429181</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631429181.jpg?v=1767770743</image:loc>
      <image:title>Die Verfassungsentwicklung in Namibia</image:title>
      <image:caption>Book cover of: Die Verfassungsentwicklung in Namibia</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vereinheitlichung-dualer-wechselkurse-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631433461</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631433461.jpg?v=1767770745</image:loc>
      <image:title>Die Vereinheitlichung dualer Wechselkurse</image:title>
      <image:caption>Book cover of: Die Vereinheitlichung dualer Wechselkurse</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vereinbarung-der-haftungsbeschraenkung-in-der-gesellschaft-buergerlichen-rechts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631461358</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631461358.jpg?v=1767770742</image:loc>
      <image:title>Die Vereinbarung der Haftungsbeschraenkung in der Gesellschaft buergerlichen Rechts</image:title>
      <image:caption>Book cover of: Die Vereinbarung der Haftungsbeschraenkung in der Gesellschaft buergerlichen Rechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-policy-and-the-politics-of-change-taylor-francis-ltd-9780415118712</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415118712.jpg?v=1767770742</image:loc>
      <image:title>Educational Policy and the Politics of Change</image:title>
      <image:caption>Book cover of: Educational Policy and the Politics of Change</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verfassungsmae-igkeit-von-anti-doping-bestimmungen-peter-lang-ag-9783631361641-ralf-lenz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631361641.jpg?v=1767770742</image:loc>
      <image:title>Die Verfassungsmaeßigkeit Von Anti-Doping-Bestimmungen</image:title>
      <image:caption>Book cover of: Die Verfassungsmaeßigkeit Von Anti-Doping-Bestimmungen. By: Ralf Lenz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-policy-and-the-mission-schools-taylor-francis-ltd-9781138866485-case-studies-from-the-british-empire</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138866485.jpg?v=1767770741</image:loc>
      <image:title>Educational Policy and the Mission Schools</image:title>
      <image:caption>Book cover of: Educational Policy and the Mission Schools</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-prophecies-of-aldous-huxley-taylor-francis-ltd-9781138832497-the-visionary-legacy-of-brave-new-world-ape-and-essence-and-island-ronald-zigler</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138832497.jpg?v=1767770744</image:loc>
      <image:title>Educational Prophecies of Aldous Huxley</image:title>
      <image:caption>Book cover of: Educational Prophecies of Aldous Huxley. By: Ronald Zigler</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-philosophy-of-elijah-muhammad-university-press-of-america-9780761836841-education-for-a-new-world-abul-pitre</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761836841.jpg?v=1767770742</image:loc>
      <image:title>Educational Philosophy of Elijah Muhammad</image:title>
      <image:caption>Book cover of: Educational Philosophy of Elijah Muhammad. By: Abul Pitre</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-psychology-john-wiley-sons-inc-9781118076132-reflection-for-action-angela-m-o-donnell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781118076132.jpg?v=1767770745</image:loc>
      <image:title>Educational Psychology</image:title>
      <image:caption>Book cover of: Educational Psychology. By: Angela M. O&apos;Donnell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verdeckten-effizienzwirkungen-der-umsatzsteuer-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631442104-eine-empirische-allgemeine-gleichgewichtsanalyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631442104.jpg?v=1767770743</image:loc>
      <image:title>Die verdeckten Effizienzwirkungen der Umsatzsteuer</image:title>
      <image:caption>Book cover of: Die verdeckten Effizienzwirkungen der Umsatzsteuer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vereinigung-demokratischer-juristen-1949-1999-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631362204-nils-eberhard-schramm</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631362204.jpg?v=1767770743</image:loc>
      <image:title>Die Vereinigung demokratischer Juristen (1949-1999)</image:title>
      <image:caption>Book cover of: Die Vereinigung demokratischer Juristen (1949-1999). By: Nils-Eberhard Schramm</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-potential-of-e-portfolios-taylor-francis-ltd-9780415412131-supporting-personal-development-and-reflective-learning-stefani-mason-p</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415412131.jpg?v=1767770742</image:loc>
      <image:title>Educational Potential of e-Portfolios</image:title>
      <image:caption>Book cover of: Educational Potential of e-Portfolios. By: Stefani/Mason/P</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-philosophy-of-elijah-muhammad-university-press-of-america-9780761869245-education-for-a-new-world-abul-pitre</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761869245.jpg?v=1767770742</image:loc>
      <image:title>Educational Philosophy of Elijah Muhammad</image:title>
      <image:caption>Book cover of: Educational Philosophy of Elijah Muhammad. By: Abul Pitre</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verdichtungsraeume-in-der-bundesrepublik-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820469752-entwicklung-neuabgrenzung-und-regionale-belastungsanalyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820469752.jpg?v=1767770743</image:loc>
      <image:title>Die Verdichtungsraeume in der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Verdichtungsraeume in der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-problems-in-turkey-taylor-francis-ltd-9780700708864-ilhan-basgoz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780700708864.jpg?v=1767770744</image:loc>
      <image:title>Educational Problems in Turkey</image:title>
      <image:caption>Book cover of: Educational Problems in Turkey. By: Ilhan Basgoz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-policy-and-the-mission-schools-taylor-francis-ltd-9780415432474-case-studies-from-the-british-empire-holmes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415432474.jpg?v=1767770743</image:loc>
      <image:title>Educational Policy and the Mission Schools</image:title>
      <image:caption>Book cover of: Educational Policy and the Mission Schools. By: Holmes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-policies-and-inequalities-in-europe-palgrave-macmillan-9780230302037-marc-demeuse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780230302037.jpg?v=1767770742</image:loc>
      <image:title>Educational Policies and Inequalities in Europe</image:title>
      <image:caption>Book cover of: Educational Policies and Inequalities in Europe. By: Marc Demeuse</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-philosophy-of-elijah-muhammad-university-press-of-america-9780761840831-education-for-a-new-world-abul-pitre</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761840831.jpg?v=1767770743</image:loc>
      <image:title>Educational Philosophy of Elijah Muhammad</image:title>
      <image:caption>Book cover of: Educational Philosophy of Elijah Muhammad. By: Abul Pitre</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verdachtsstrafe-in-der-kriminalwissenschaftlichen-literatur-des-18-und-19-jahrhunderts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631457870</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631457870.jpg?v=1767770743</image:loc>
      <image:title>Die Verdachtsstrafe in der kriminalwissenschaftlichen Literatur des 18. und 19. Jahrhunderts</image:title>
      <image:caption>Book cover of: Die Verdachtsstrafe in der kriminalwissenschaftlichen Literatur des 18. und 19. Jahrhunderts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-planning-taylor-francis-inc-9780815320241-the-international-dimension-jacques-hallak</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815320241.jpg?v=1767770743</image:loc>
      <image:title>Educational Planning</image:title>
      <image:caption>Book cover of: Educational Planning. By: Jacques Hallak</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-policy-borrowing-in-china-taylor-francis-ltd-9780415743242-looking-west-or-looking-east-charlene-tan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415743242.jpg?v=1767770743</image:loc>
      <image:title>Educational Policy Borrowing in China</image:title>
      <image:caption>Book cover of: Educational Policy Borrowing in China. By: Charlene Tan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-philosophy-of-elijah-muhammad-university-press-of-america-9780761865803-education-for-a-new-world-abul-pitre</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761865803.jpg?v=1767770748</image:loc>
      <image:title>Educational Philosophy of Elijah Muhammad</image:title>
      <image:caption>Book cover of: Educational Philosophy of Elijah Muhammad. By: Abul Pitre</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verdeckte-gewinnausschuettung-im-schnittpunkt-von-gmbh-recht-bilanzrecht-und-steuerrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820453973-zur-frage-der-vermeidbarkeit-steuerlicher-verdeckter-gewinnaus-schuettungen-bei-gesellscha</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820453973.jpg?v=1767770744</image:loc>
      <image:title>Die verdeckte Gewinnausschuettung im Schnittpunkt von GmbH-Recht, Bilanzrecht und Steuerrecht</image:title>
      <image:caption>Book cover of: Die verdeckte Gewinnausschuettung im Schnittpunkt von GmbH-Recht, Bilanzrecht und Steuerrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verbraucherbeteiligung-am-gewinn-als-freistellungsvoraussetzung-nach-art-85-abs-3-ewgv-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631466674-eine-analyse-der-entscheidungspraxis-der-kommission-der-europaeischen-gemeinschaften</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631466674.jpg?v=1767770747</image:loc>
      <image:title>Die Verbraucherbeteiligung am Gewinn als Freistellungsvoraussetzung nach Art. 85 Abs. 3 EWGV</image:title>
      <image:caption>Book cover of: Die Verbraucherbeteiligung am Gewinn als Freistellungsvoraussetzung nach Art. 85 Abs. 3 EWGV</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verbindung-von-strafsachen-im-erwachsenenstrafrecht-peter-lang-international-academic-publishers-9783261010186</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261010186.jpg?v=1767770746</image:loc>
      <image:title>Die Verbindung von Strafsachen im Erwachsenenstrafrecht</image:title>
      <image:caption>Book cover of: Die Verbindung von Strafsachen im Erwachsenenstrafrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verbalgroesse-imperativ-im-spanischen-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906757506-ueberlegungen-zum-grundwert-des-spanischen-imperativs-und-seiner-stellung-innerhalb-des-modussystems-martin-gyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906757506.jpg?v=1767770745</image:loc>
      <image:title>Die Verbalgroesse Imperativ im Spanischen</image:title>
      <image:caption>Book cover of: Die Verbalgroesse Imperativ im Spanischen. By: Martin Gyse</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verbesserung-der-warenerzeugung-oder-verteilung-und-die-foerderung-des-technischen-oder-wirtschaftlichen-fortschritts-nach-art-85-abs-3-ewg-vertrag-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631465684-ein-beitrag-zur-freistellungspr</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631465684.jpg?v=1767770747</image:loc>
      <image:title>Die Verbesserung der Warenerzeugung oder -verteilung und die Foerderung des technischen oder wirtschaftlichen Fortschritts nach Art. 85 Abs. 3 EWG-Vertrag</image:title>
      <image:caption>Book cover of: Die Verbesserung der Warenerzeugung oder -verteilung und die Foerderung des technischen oder wirtschaftlichen Fortschritts nach Art. 85 Abs. 3 EWG-Vertrag</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verbrechensverabredung-30-abs-2-3-alt-stgb-peter-lang-ag-9783631375457</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631375457.jpg?v=1767770743</image:loc>
      <image:title>Die Verbrechensverabredung, - § 30 Abs. 2, 3. Alt. Stgb</image:title>
      <image:caption>Book cover of: Die Verbrechensverabredung, - § 30 Abs. 2, 3. Alt. Stgb</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-philosophy-in-the-french-enlightenment-taylor-francis-ltd-9780754662891-from-nature-to-second-nature-natasha-gill</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780754662891.jpg?v=1767770743</image:loc>
      <image:title>Educational Philosophy in the French Enlightenment</image:title>
      <image:caption>Book cover of: Educational Philosophy in the French Enlightenment. By: Natasha Gill</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verben-der-fortbewegung-im-russischen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876901770-eine-unterrichtseinheit-notizen-und-materialien-zur-russischen-linguistik-5-rupprecht-s-baur</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876901770.jpg?v=1767770744</image:loc>
      <image:title>Die Verben der Fortbewegung im Russischen</image:title>
      <image:caption>Book cover of: Die Verben der Fortbewegung im Russischen. By: Rupprecht S. Baur</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-outcomes-for-students-with-disabilities-taylor-francis-ltd-9781138968448-james-e-ysseldyke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138968448.jpg?v=1767770743</image:loc>
      <image:title>Educational Outcomes for Students With Disabilities</image:title>
      <image:caption>Book cover of: Educational Outcomes for Students With Disabilities. By: James E. Ysseldyke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verdeckten-sacheinlagen-in-frankreich-belgien-und-deutschland-und-ihre-behandlung-durch-die-zweite-eu-gesellschaftsrechtsrichtlinie-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631301555</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631301555.jpg?v=1767770744</image:loc>
      <image:title>Die verdeckten Sacheinlagen in Frankreich, Belgien und Deutschland und ihre Behandlung durch die zweite EU-Gesellschaftsrechtsrichtlinie</image:title>
      <image:caption>Book cover of: Die verdeckten Sacheinlagen in Frankreich, Belgien und Deutschland und ihre Behandlung durch die zweite EU-Gesellschaftsrechtsrichtlinie</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verantwortung-des-arztes-fuer-fehlverhalten-des-patienten-am-beispiel-der-mi-achtung-aerztlicher-hinweise-peter-lang-ag-9783631437414</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631437414.jpg?v=1767770746</image:loc>
      <image:title>Die Verantwortung Des Arztes Fuer Fehlverhalten Des Patienten Am Beispiel Der Mißachtung Aerztlicher Hinweise</image:title>
      <image:caption>Book cover of: Die Verantwortung Des Arztes Fuer Fehlverhalten Des Patienten Am Beispiel Der Mißachtung Aerztlicher Hinweise</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-philosophy-of-elijah-muhammad-university-press-of-america-9780761840824-education-for-a-new-world-abul-pitre</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761840824.jpg?v=1767770745</image:loc>
      <image:title>Educational Philosophy of Elijah Muhammad</image:title>
      <image:caption>Book cover of: Educational Philosophy of Elijah Muhammad. By: Abul Pitre</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verdienstausfallversicherung-fuer-see-und-binnenschiffe-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631314104-moritz-mittelbach</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631314104.jpg?v=1767770747</image:loc>
      <image:title>Die Verdienstausfallversicherung fuer See- und Binnenschiffe</image:title>
      <image:caption>Book cover of: Die Verdienstausfallversicherung fuer See- und Binnenschiffe. By: Moritz Mittelbach</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-objectives-and-the-teaching-of-educational-psychology-taylor-francis-ltd-9780415678421-edgar-stones</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415678421.jpg?v=1767770746</image:loc>
      <image:title>Educational Objectives and the Teaching of Educational Psychology</image:title>
      <image:caption>Book cover of: Educational Objectives and the Teaching of Educational Psychology. By: Edgar Stones</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-management-sage-publications-inc-9780761965558-redefining-theory-policy-and-practice</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761965558.jpg?v=1767770746</image:loc>
      <image:title>Educational Management</image:title>
      <image:caption>Book cover of: Educational Management</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-opportunity-taylor-francis-ltd-9780754678670-the-geography-of-access-to-higher-education-alexander-d-singleton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780754678670.jpg?v=1767770744</image:loc>
      <image:title>Educational Opportunity</image:title>
      <image:caption>Book cover of: Educational Opportunity. By: Alexander D. Singleton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verbesserung-des-anlegerschutzes-im-investmentrecht-durch-die-bildung-von-risikoklassen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631480359</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631480359.jpg?v=1767770744</image:loc>
      <image:title>Die Verbesserung des Anlegerschutzes im Investmentrecht durch die Bildung von Risikoklassen</image:title>
      <image:caption>Book cover of: Die Verbesserung des Anlegerschutzes im Investmentrecht durch die Bildung von Risikoklassen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-management-sage-publications-inc-9780761965541-redefining-theory-policy-and-practice</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761965541.jpg?v=1767770744</image:loc>
      <image:title>Educational Management</image:title>
      <image:caption>Book cover of: Educational Management</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-philosophy-and-new-french-thought-taylor-francis-ltd-9780367235024-david-r-cole</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367235024.jpg?v=1767770748</image:loc>
      <image:title>Educational Philosophy and New French Thought</image:title>
      <image:caption>Book cover of: Educational Philosophy and New French Thought. By: David R. Cole</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-philosophy-for-a-post-secular-age-taylor-francis-ltd-9781138923669-david-lewin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138923669.jpg?v=1767770746</image:loc>
      <image:title>Educational Philosophy for a Post-secular Age</image:title>
      <image:caption>Book cover of: Educational Philosophy for a Post-secular Age. By: David Lewin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-objectives-and-the-teaching-of-educational-psychology-taylor-francis-ltd-9780415750547-edgar-stones</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415750547.jpg?v=1767770746</image:loc>
      <image:title>Educational Objectives and the Teaching of Educational Psychology</image:title>
      <image:caption>Book cover of: Educational Objectives and the Teaching of Educational Psychology. By: Edgar Stones</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verankerung-des-subsidiaritaetsprinzips-im-grundgesetz-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631334270-ein-beitrag-zur-bedeutung-des-subsidiaritaetsprinzips-fuer-die-kompetenzabgrenzung-im-bundesstaat</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631334270.jpg?v=1767770747</image:loc>
      <image:title>Die Verankerung des Subsidiaritaetsprinzips im Grundgesetz</image:title>
      <image:caption>Book cover of: Die Verankerung des Subsidiaritaetsprinzips im Grundgesetz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-metamorphoses-bloomsbury-publishing-plc-9780742546738-philosophical-reflections-on-identity-and-culture-jane-roland-martin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780742546738.jpg?v=1767770749</image:loc>
      <image:title>Educational Metamorphoses</image:title>
      <image:caption>Book cover of: Educational Metamorphoses. By: Jane Roland Martin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-philosophy-and-new-french-thought-taylor-francis-ltd-9781138080669-david-r-cole</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138080669.jpg?v=1767770745</image:loc>
      <image:title>Educational Philosophy and New French Thought</image:title>
      <image:caption>Book cover of: Educational Philosophy and New French Thought. By: David R. Cole</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-veraenderte-wettbewerbssituation-auf-dem-eg-milchmarkt-durch-die-aufhebung-der-produktions-und-absatzbeschraenkungen-fuer-milchimitate-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631449592</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631449592.jpg?v=1767770746</image:loc>
      <image:title>Die veraenderte Wettbewerbssituation auf dem EG-Milchmarkt durch die Aufhebung der Produktions- und Absatzbeschraenkungen fuer Milchimitate</image:title>
      <image:caption>Book cover of: Die veraenderte Wettbewerbssituation auf dem EG-Milchmarkt durch die Aufhebung der Produktions- und Absatzbeschraenkungen fuer Milchimitate</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-legacy-of-romanticism-wilfrid-laurier-university-press-9780889209961</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780889209961.jpg?v=1767770744</image:loc>
      <image:title>Educational Legacy of Romanticism</image:title>
      <image:caption>Book cover of: Educational Legacy of Romanticism</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-management-taylor-francis-ltd-9780415276511-major-themes-in-education-h-tomlinson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415276511.jpg?v=1767770746</image:loc>
      <image:title>Educational Management</image:title>
      <image:caption>Book cover of: Educational Management. By: H. Tomlinson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-metamorphoses-bloomsbury-publishing-plc-9780742546721-philosophical-reflections-on-identity-and-culture-jane-roland-martin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780742546721.jpg?v=1767770745</image:loc>
      <image:title>Educational Metamorphoses</image:title>
      <image:caption>Book cover of: Educational Metamorphoses. By: Jane Roland Martin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-opportunity-taylor-francis-ltd-9781138272392-the-geography-of-access-to-higher-education-alexander-d-singleton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138272392.jpg?v=1767770747</image:loc>
      <image:title>Educational Opportunity</image:title>
      <image:caption>Book cover of: Educational Opportunity. By: Alexander D. Singleton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-lockout-of-african-americans-in-prince-edward-county-virginia-1959-1964-university-press-of-america-9780761850632-personal-accounts-and-reflections-terence-hicks</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761850632.jpg?v=1767770745</image:loc>
      <image:title>Educational Lockout of African Americans in Prince Edward County, Virginia (1959-1964)</image:title>
      <image:caption>Book cover of: Educational Lockout of African Americans in Prince Edward County, Virginia (1959-1964). By: Terence Hicks</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-variabilitaet-relativer-preisaenderungen-und-die-varianz-monetaerer-aggregate-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820490749</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820490749.jpg?v=1767770747</image:loc>
      <image:title>Die Variabilitaet relativer Preisaenderungen und die Varianz monetaerer Aggregate</image:title>
      <image:caption>Book cover of: Die Variabilitaet relativer Preisaenderungen und die Varianz monetaerer Aggregate</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-of-immigrants-taylor-francis-ltd-9780367186258-case-studies-in-times-of-change-emily-r-crawford</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367186258.jpg?v=1767770748</image:loc>
      <image:title>Educational Leadership of Immigrants</image:title>
      <image:caption>Book cover of: Educational Leadership of Immigrants. By: Emily R. Crawford</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-verbandsrechtliche-stellung-des-gewerkschaftsmitglieds-im-streik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631417423</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631417423.jpg?v=1767770746</image:loc>
      <image:title>Die verbandsrechtliche Stellung des Gewerkschaftsmitglieds im Streik</image:title>
      <image:caption>Book cover of: Die verbandsrechtliche Stellung des Gewerkschaftsmitglieds im Streik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-planning-bloomsbury-publishing-plc-9780810842977-strategic-tactical-and-operational-jerry-herman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780810842977.jpg?v=1767770747</image:loc>
      <image:title>Educational Planning</image:title>
      <image:caption>Book cover of: Educational Planning. By: Jerry Herman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-in-becoming-taylor-francis-ltd-9781138689336-on-the-potential-of-leadership-in-action-nuraan-davids</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138689336.jpg?v=1767770747</image:loc>
      <image:title>Educational Leadership in Becoming</image:title>
      <image:caption>Book cover of: Educational Leadership in Becoming. By: Nuraan Davids</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-lockout-of-african-americans-in-prince-edward-county-virginia-1959-1964-university-press-of-america-9780761850625-personal-accounts-and-reflections-terence-hicks</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761850625.jpg?v=1767770746</image:loc>
      <image:title>Educational Lockout of African Americans in Prince Edward County, Virginia (1959-1964)</image:title>
      <image:caption>Book cover of: Educational Lockout of African Americans in Prince Edward County, Virginia (1959-1964). By: Terence Hicks</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-organizational-learning-and-the-ideas-of-karl-weick-taylor-francis-ltd-9781138080003-perspectives-on-theory-and-practice-bob-l-johnson-jr</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138080003.jpg?v=1767770745</image:loc>
      <image:title>Educational Leadership, Organizational Learning, and the Ideas of Karl Weick</image:title>
      <image:caption>Book cover of: Educational Leadership, Organizational Learning, and the Ideas of Karl Weick. By: Bob L. Johnson Jr.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-urteilsgruende-im-strafverfahren-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820401905</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820401905.jpg?v=1767770746</image:loc>
      <image:title>Die Urteilsgruende im Strafverfahren</image:title>
      <image:caption>Book cover of: Die Urteilsgruende im Strafverfahren</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-veraeuerung-von-anteilen-an-einer-kapitalgesellschaft-und-deren-auswirkung-auf-die-steuerliche-behandlung-des-gewinnanspruchs-der-gesellschafter-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631408292-unter-besonderer-beruecksichtigung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631408292.jpg?v=1767770747</image:loc>
      <image:title>Die Veraeuerung von Anteilen an einer Kapitalgesellschaft und deren Auswirkung auf die steuerliche Behandlung des Gewinnanspruchs der Gesellschafter</image:title>
      <image:caption>Book cover of: Die Veraeuerung von Anteilen an einer Kapitalgesellschaft und deren Auswirkung auf die steuerliche Behandlung des Gewinnanspruchs der Gesellschafter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-in-action-taylor-francis-ltd-9781138020993-a-casebook-for-aspiring-educational-leaders-leila-sadeghi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138020993.jpg?v=1767770745</image:loc>
      <image:title>Educational Leadership in Action</image:title>
      <image:caption>Book cover of: Educational Leadership in Action. By: Leila Sadeghi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-philosophy-taylor-francis-inc-9780815319719-a-history-from-the-ancient-world-to-modern-america</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815319719.jpg?v=1767770746</image:loc>
      <image:title>Educational Philosophy</image:title>
      <image:caption>Book cover of: Educational Philosophy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-uvp-in-parallelen-und-konzentrierten-verfahren-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631318171-eine-untersuchung-unter-besonderer-beruecksichtigung-europarechtlicher-vorgaben-am-beispiel-immissionsschutzrechtlicher-und-gentechn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631318171.jpg?v=1767770747</image:loc>
      <image:title>Die UVP in parallelen und konzentrierten Verfahren</image:title>
      <image:caption>Book cover of: Die UVP in parallelen und konzentrierten Verfahren</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-of-immigrants-taylor-francis-ltd-9780367186272-case-studies-in-times-of-change-emily-r-crawford</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367186272.jpg?v=1767770748</image:loc>
      <image:title>Educational Leadership of Immigrants</image:title>
      <image:caption>Book cover of: Educational Leadership of Immigrants. By: Emily R. Crawford</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-urheberverguetung-im-franzoesischen-urheberrechtsgesetz-loi-sur-la-propriete-litteraire-et-artistique-peter-lang-international-academic-publishers-9783261015549-loi-sur-la-propriete-litteraire-et-artistique</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261015549.jpg?v=1767770749</image:loc>
      <image:title>Die Urheberverguetung im franzoesischen Urheberrechtsgesetz- (Loi sur la propriete litteraire et artistique)</image:title>
      <image:caption>Book cover of: Die Urheberverguetung im franzoesischen Urheberrechtsgesetz- (Loi sur la propriete litteraire et artistique)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-and-the-community-pearson-education-limited-9780273661641-strategies-for-school-improvement-through-community-engagement</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780273661641.jpg?v=1767770750</image:loc>
      <image:title>Educational Leadership and the Community</image:title>
      <image:caption>Book cover of: Educational Leadership and the Community</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-and-technology-taylor-francis-ltd-9780415809788-preparing-school-administrators-for-a-digital-age-virginia-e-garland</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415809788.jpg?v=1767770748</image:loc>
      <image:title>Educational Leadership and Technology</image:title>
      <image:caption>Book cover of: Educational Leadership and Technology. By: Virginia E. Garland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ursachenvermutungen-des-umwelthaftungs-und-des-gentechnikgesetzes-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631480342</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631480342.jpg?v=1767770749</image:loc>
      <image:title>Die Ursachenvermutungen des Umwelthaftungs- und des Gentechnikgesetzes</image:title>
      <image:caption>Book cover of: Die Ursachenvermutungen des Umwelthaftungs- und des Gentechnikgesetzes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unterstuetzung-der-produktentwicklung-durch-interfunktionale-kommunikation-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631481073</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631481073.jpg?v=1767770748</image:loc>
      <image:title>Die Unterstuetzung der Produktentwicklung durch interfunktionale Kommunikation</image:title>
      <image:caption>Book cover of: Die Unterstuetzung der Produktentwicklung durch interfunktionale Kommunikation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unterstuetzung-der-demokratie-in-deutschland-und-italien-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631312650-eine-empirische-analyse-zum-einflu-der-traditionellen-politischen-teilkulturen-1959-bis-1992</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631312650.jpg?v=1767770752</image:loc>
      <image:title>Die Unterstuetzung der Demokratie in Deutschland und Italien</image:title>
      <image:caption>Book cover of: Die Unterstuetzung der Demokratie in Deutschland und Italien</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-and-technology-taylor-francis-ltd-9780415809764-preparing-school-administrators-for-a-digital-age-virginia-e-garland</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415809764.jpg?v=1767770748</image:loc>
      <image:title>Educational Leadership and Technology</image:title>
      <image:caption>Book cover of: Educational Leadership and Technology. By: Virginia E. Garland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-untersuchungsmaxime-im-aelteren-verwaltungsproze-peter-lang-ag-9783631347416-martin-richter</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631347416.jpg?v=1767770747</image:loc>
      <image:title>Die Untersuchungsmaxime Im Aelteren Verwaltungsprozeß</image:title>
      <image:caption>Book cover of: Die Untersuchungsmaxime Im Aelteren Verwaltungsprozeß. By: Martin Richter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-in-action-taylor-francis-ltd-9781138020986-a-casebook-for-aspiring-educational-leaders-leila-sadeghi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138020986.jpg?v=1767770750</image:loc>
      <image:title>Educational Leadership in Action</image:title>
      <image:caption>Book cover of: Educational Leadership in Action. By: Leila Sadeghi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unvereinbarkeitserklaerung-verfassungswidriger-steuergesetze-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631481721-eine-untersuchung-zu-den-verfassungsrechtlichen-grundlagen-und-den-folgen-fuer-das-steuerverfahren</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631481721.jpg?v=1767770748</image:loc>
      <image:title>Die Unvereinbarkeitserklaerung verfassungswidriger Steuergesetze</image:title>
      <image:caption>Book cover of: Die Unvereinbarkeitserklaerung verfassungswidriger Steuergesetze</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-urspruenge-des-strukturellen-ungleichgewichts-und-seine-wirkung-auf-den-entwicklungsprozess-griechenlands-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820454406</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820454406.jpg?v=1767770747</image:loc>
      <image:title>Die Urspruenge des strukturellen Ungleichgewichts und seine Wirkung auf den Entwicklungsprozess Griechenlands</image:title>
      <image:caption>Book cover of: Die Urspruenge des strukturellen Ungleichgewichts und seine Wirkung auf den Entwicklungsprozess Griechenlands</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-for-transformation-and-social-justice-taylor-francis-ltd-9781138923539-narratives-of-change-in-south-africa-john-ambrosio</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138923539.jpg?v=1767770751</image:loc>
      <image:title>Educational Leadership for Transformation and Social Justice</image:title>
      <image:caption>Book cover of: Educational Leadership for Transformation and Social Justice. By: John Ambrosio</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unternehmung-als-potential-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820467642-ueberlegungen-zur-erklaerung-der-entwicklungsmoeglichkeiten-speziell-kleiner-und-mittelgrosser-unternehmungen-unter-besonderer-beruecksichtigung-ihrer-f</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820467642.jpg?v=1767770749</image:loc>
      <image:title>Die Unternehmung als Potential</image:title>
      <image:caption>Book cover of: Die Unternehmung als Potential</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-as-a-culturally-constructed-practice-taylor-francis-ltd-9780367271930-new-directions-and-possibilities</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367271930.jpg?v=1767770748</image:loc>
      <image:title>Educational Leadership as a Culturally-Constructed Practice</image:title>
      <image:caption>Book cover of: Educational Leadership as a Culturally-Constructed Practice</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-variabilitaet-des-realen-wechselkurses-und-ihre-oekonomischen-auswirkungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631494547-eine-untersuchung-am-beispiel-korea</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631494547.jpg?v=1767770748</image:loc>
      <image:title>Die Variabilitaet des realen Wechselkurses und ihre oekonomischen Auswirkungen</image:title>
      <image:caption>Book cover of: Die Variabilitaet des realen Wechselkurses und ihre oekonomischen Auswirkungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-and-pierre-bourdieu-taylor-francis-ltd-9780415603553-pat-thomson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415603553.jpg?v=1767770749</image:loc>
      <image:title>Educational Leadership and Pierre Bourdieu</image:title>
      <image:caption>Book cover of: Educational Leadership and Pierre Bourdieu. By: Pat Thomson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unterscheidung-von-vorsatzausschliessendem-und-nichtvorsatzausschliessendem-irrtum-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820498318</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820498318.jpg?v=1767770747</image:loc>
      <image:title>Die Unterscheidung von vorsatzausschliessendem und nichtvorsatzausschliessendem Irrtum</image:title>
      <image:caption>Book cover of: Die Unterscheidung von vorsatzausschliessendem und nichtvorsatzausschliessendem Irrtum</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-linguistics-taylor-francis-ltd-9780415588393-nancy-h-hornberger</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415588393.jpg?v=1767770747</image:loc>
      <image:title>Educational Linguistics</image:title>
      <image:caption>Book cover of: Educational Linguistics. By: Nancy H. Hornberger</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unterhaltspflicht-des-hausmanns-gegenueber-barunterhaltsberechtigten-minderjaehrigen-unverheirateten-kindern-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631302538-zur-unterhaltspflicht-wiederverheirateter-geschiedener</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631302538.jpg?v=1767770750</image:loc>
      <image:title>Die Unterhaltspflicht des «Hausmanns» gegenueber barunterhaltsberechtigten minderjaehrigen unverheirateten Kindern</image:title>
      <image:caption>Book cover of: Die Unterhaltspflicht des «Hausmanns» gegenueber barunterhaltsberechtigten minderjaehrigen unverheirateten Kindern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-vater-kind-zuordnung-aufgrund-der-ehe-der-mutter-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631460825-eine-vergleichende-darstellung-des-deutschen-und-franzoesischen-rechts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631460825.jpg?v=1767770750</image:loc>
      <image:title>Die Vater-Kind-Zuordnung aufgrund der Ehe der Mutter</image:title>
      <image:caption>Book cover of: Die Vater-Kind-Zuordnung aufgrund der Ehe der Mutter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unverzichtbarkeit-von-arbeitsvertraglichen-anspruechen-peter-lang-international-academic-publishers-9783261039019</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261039019.jpg?v=1767770748</image:loc>
      <image:title>Die Unverzichtbarkeit von arbeitsvertraglichen Anspruechen</image:title>
      <image:caption>Book cover of: Die Unverzichtbarkeit von arbeitsvertraglichen Anspruechen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ursachen-der-schuldenkrise-in-lateinamerika-und-ihre-empirische-ueberpruefung-am-beispiel-von-venezuela-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631474747</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631474747.jpg?v=1767770749</image:loc>
      <image:title>Die Ursachen der Schuldenkrise in Lateinamerika und ihre empirische Ueberpruefung am Beispiel von Venezuela</image:title>
      <image:caption>Book cover of: Die Ursachen der Schuldenkrise in Lateinamerika und ihre empirische Ueberpruefung am Beispiel von Venezuela</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-urkundendelikte-im-deutschen-und-koreanischen-strafrecht-peter-lang-ag-9783631320693-unter-besonderer-beruecksichtigung-der-behandlung-von-kopien-chen-chel-ryu</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631320693.jpg?v=1767770750</image:loc>
      <image:title>Die Urkundendelikte Im Deutschen Und Koreanischen Strafrecht</image:title>
      <image:caption>Book cover of: Die Urkundendelikte Im Deutschen Und Koreanischen Strafrecht. By: Chen-Chel Ryu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-and-hannah-arendt-taylor-francis-ltd-9781138926646-helen-m-gunter</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138926646.jpg?v=1767770751</image:loc>
      <image:title>Educational Leadership and Hannah Arendt</image:title>
      <image:caption>Book cover of: Educational Leadership and Hannah Arendt. By: Helen M. Gunter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-and-michel-foucault-taylor-francis-ltd-9781138926660-donald-gillies</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138926660.jpg?v=1767770746</image:loc>
      <image:title>Educational Leadership and Michel Foucault</image:title>
      <image:caption>Book cover of: Educational Leadership and Michel Foucault. By: Donald Gillies</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unterschrift-des-nachbarn-unter-bauvorlagen-nach-saarlaendischem-recht-peter-lang-ag-9783631555088-zugleich-ein-beitrag-zur-saarlaendischen-nachbarbeteiligung-nach-71-landesbauordnung-des-saarlandes-pierre-d-kago</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631555088.jpg?v=1767770749</image:loc>
      <image:title>Die Unterschrift Des Nachbarn Unter Bauvorlagen Nach Saarlaendischem Recht</image:title>
      <image:caption>Book cover of: Die Unterschrift Des Nachbarn Unter Bauvorlagen Nach Saarlaendischem Recht. By: Pierre D. Kago</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-sage-publications-inc-9780761967422-ambiguity-professionals-and-managerialism-eric-hoyle</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761967422.jpg?v=1767770749</image:loc>
      <image:title>Educational Leadership</image:title>
      <image:caption>Book cover of: Educational Leadership. By: Eric Hoyle</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unterrepraesentanz-von-frauen-in-schulleitungen-peter-lang-ag-9783631536179-moegliche-ursachen-aus-naturwissenschaftlich-anthropologischer-perspektive-dorothea-hobeck</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631536179.jpg?v=1767770751</image:loc>
      <image:title>Die Unterrepraesentanz Von Frauen in Schulleitungen</image:title>
      <image:caption>Book cover of: Die Unterrepraesentanz Von Frauen in Schulleitungen. By: Dorothea Hobeck</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-and-nancy-fraser-taylor-francis-ltd-9781138022027-jill-blackmore</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138022027.jpg?v=1767770750</image:loc>
      <image:title>Educational Leadership and Nancy Fraser</image:title>
      <image:caption>Book cover of: Educational Leadership and Nancy Fraser. By: Jill Blackmore</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-untreue-zum-nachteil-der-gmbh-bei-vorheriger-zustimmung-aller-gesellschafter-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631463185</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631463185.jpg?v=1767770748</image:loc>
      <image:title>Die Untreue zum Nachteil der GmbH bei vorheriger Zustimmung aller Gesellschafter</image:title>
      <image:caption>Book cover of: Die Untreue zum Nachteil der GmbH bei vorheriger Zustimmung aller Gesellschafter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-and-planning-for-technology-pearson-education-us-9780137058228-anthony-g-picciano</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780137058228.jpg?v=1767770749</image:loc>
      <image:title>Educational Leadership and Planning for Technology</image:title>
      <image:caption>Book cover of: Educational Leadership and Planning for Technology. By: Anthony G. Picciano</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unmittelbare-wirkung-des-verbots-der-nichttarifaeren-handelshemmnisse-art-30-ewgv-in-den-rechtsbeziehungen-zwischen-privaten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820401837-probleme-der-horizontalen-unmittelbaren-wirkung-des-ge</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820401837.jpg?v=1767770751</image:loc>
      <image:title>Die unmittelbare Wirkung des Verbots der nichttarifaeren Handelshemmnisse (Art. 30 EWGV) in den Rechtsbeziehungen zwischen Privaten</image:title>
      <image:caption>Book cover of: Die unmittelbare Wirkung des Verbots der nichttarifaeren Handelshemmnisse (Art. 30 EWGV) in den Rechtsbeziehungen zwischen Privaten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-and-management-developing-insights-and-skills-open-university-press-9780335236084-craw</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780335236084.jpg?v=1767770749</image:loc>
      <image:title>Educational Leadership and Management: Developing Insights and Skills</image:title>
      <image:caption>Book cover of: Educational Leadership and Management: Developing Insights and Skills. By: Craw</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unikondylare-schlittenprothese-pro-contra-steinkopff-9783642621710-klaus-buckup</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783642621710.jpg?v=1767770750</image:loc>
      <image:title>Die unikondylare Schlittenprothese Pro &amp; Contra</image:title>
      <image:caption>Book cover of: Die unikondylare Schlittenprothese Pro &amp; Contra. By: Klaus Buckup</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-taylor-francis-ltd-9780367202170-theorising-professional-practice-in-neoliberal-times-steven-j-courtney</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367202170.jpg?v=1767770748</image:loc>
      <image:title>Educational Leadership</image:title>
      <image:caption>Book cover of: Educational Leadership. By: Steven J. Courtney</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unmittelbarkeit-der-beweisaufnahme-im-zivilproze-insbesondere-bei-der-zeugenvernehmung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631428306</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631428306.jpg?v=1767770749</image:loc>
      <image:title>Die Unmittelbarkeit der Beweisaufnahme im Zivilproze, insbesondere bei der Zeugenvernehmung</image:title>
      <image:caption>Book cover of: Die Unmittelbarkeit der Beweisaufnahme im Zivilproze, insbesondere bei der Zeugenvernehmung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ungeliebte-zivilisation-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631482193-zivilisationskritik-und-ethnologie-in-deutschland-im-20-jahrhundert</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631482193.jpg?v=1767770750</image:loc>
      <image:title>Die ungeliebte «Zivilisation»</image:title>
      <image:caption>Book cover of: Die ungeliebte «Zivilisation»</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-sage-publications-inc-9780761967439-ambiguity-professionals-and-managerialism-eric-hoyle</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761967439.jpg?v=1767770747</image:loc>
      <image:title>Educational Leadership</image:title>
      <image:caption>Book cover of: Educational Leadership. By: Eric Hoyle</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unsicherheitseinrede-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820415421-eine-rechtsvergleichende-untersuchung-ueber-die-rechte-eines-vertragspartners-bei-vermoegensverschlechterung-der-anderen-partei-zum-deutschen-und-us-amerikani</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820415421.jpg?v=1767770750</image:loc>
      <image:title>Die Unsicherheitseinrede</image:title>
      <image:caption>Book cover of: Die Unsicherheitseinrede</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unternehmensbesteuerung-in-deutschland-und-grobritannien-vor-dem-hintergrund-des-europaeischen-integrationsprozesses-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631303146</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631303146.jpg?v=1767770749</image:loc>
      <image:title>Die Unternehmensbesteuerung in Deutschland und Grobritannien vor dem Hintergrund des europaeischen Integrationsprozesses</image:title>
      <image:caption>Book cover of: Die Unternehmensbesteuerung in Deutschland und Grobritannien vor dem Hintergrund des europaeischen Integrationsprozesses</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leader-s-guide-for-school-scheduling-taylor-francis-ltd-9781138207394-strategies-addressing-grades-k-12-elliott-merenbloom</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138207394.jpg?v=1767770749</image:loc>
      <image:title>Educational Leader&apos;s Guide for School Scheduling</image:title>
      <image:caption>Book cover of: Educational Leader&apos;s Guide for School Scheduling. By: Elliott Merenbloom</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unternehmensberatung-als-externe-stabsstelle-des-managements-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820487091-eine-untersuchung-der-funktionen-und-bedeutung-der-unternehmensberatung-unter-besonderer-beruecksichtigung-ihrer-relev</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820487091.jpg?v=1767770748</image:loc>
      <image:title>Die Unternehmensberatung als externe Stabsstelle des Managements</image:title>
      <image:caption>Book cover of: Die Unternehmensberatung als externe Stabsstelle des Managements</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-sage-publications-inc-9780761971702-culture-and-diversity-clive-dimmock</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761971702.jpg?v=1767770750</image:loc>
      <image:title>Educational Leadership</image:title>
      <image:caption>Book cover of: Educational Leadership. By: Clive Dimmock</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-sage-publications-inc-9780761971696-culture-and-diversity-clive-dimmock</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761971696.jpg?v=1767770753</image:loc>
      <image:title>Educational Leadership</image:title>
      <image:caption>Book cover of: Educational Leadership. By: Clive Dimmock</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unmoegliche-synthese-peter-lang-international-academic-publishers-9783261033215-heines-fruehwerk-im-spannungsfeld-von-petrarkistischer-tradition-und-fruehromantischer-dichtungstheorie</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261033215.jpg?v=1767770750</image:loc>
      <image:title>Die unmoegliche Synthese</image:title>
      <image:caption>Book cover of: Die unmoegliche Synthese</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-and-michel-foucault-taylor-francis-ltd-9780415633123</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415633123.jpg?v=1767770750</image:loc>
      <image:title>Educational Leadership and Michel Foucault</image:title>
      <image:caption>Book cover of: Educational Leadership and Michel Foucault</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-universitaetsbibliothek-bonn-in-der-zeit-des-nationalsozialismus-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783899756883-personal-erwerbung-benutzung-frank-krosta</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783899756883.jpg?v=1767770750</image:loc>
      <image:title>Die Universitaetsbibliothek Bonn in Der Zeit Des Nationalsozialismus</image:title>
      <image:caption>Book cover of: Die Universitaetsbibliothek Bonn in Der Zeit Des Nationalsozialismus. By: Frank Krosta</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-united-nations-compensation-commission-peter-lang-ag-9783631342848-eine-darstellung-von-aufbau-und-verfahren-sowie-der-historischen-und-rechtlichen-grundlagen-verena-jutte</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631342848.jpg?v=1767770749</image:loc>
      <image:title>Die United Nations Compensation Commission</image:title>
      <image:caption>Book cover of: Die United Nations Compensation Commission. By: Verena Jutte</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-innovators-1750-1967-palgrave-macmillan-9780333804278-2-volume-set</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780333804278.jpg?v=1767770751</image:loc>
      <image:title>Educational Innovators, 1750-1967</image:title>
      <image:caption>Book cover of: Educational Innovators, 1750-1967</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-uno-friedensoperation-in-kambodscha-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631315446-vorgeschichte-konzept-verlauf-und-kritische-evaluierung-des-internationalen-engagements</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631315446.jpg?v=1767770749</image:loc>
      <image:title>Die UNO-Friedensoperation in Kambodscha</image:title>
      <image:caption>Book cover of: Die UNO-Friedensoperation in Kambodscha</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-cambridge-university-press-9781107637894-together-creating-ethical-learning-environments-patrick-duignan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781107637894.jpg?v=1767770750</image:loc>
      <image:title>Educational Leadership</image:title>
      <image:caption>Book cover of: Educational Leadership. By: Patrick Duignan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-veraenderung-von-rechtfertigungsgruenden-durch-rechtsprechung-und-lehre-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631433034-moderne-strafrechtsdogmatik-zwischen-rechtsstaatsprinzip-und-kriminalpolitik</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631433034.jpg?v=1767770749</image:loc>
      <image:title>Die Veraenderung von Rechtfertigungsgruenden durch Rechtsprechung und Lehre</image:title>
      <image:caption>Book cover of: Die Veraenderung von Rechtfertigungsgruenden durch Rechtsprechung und Lehre</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-and-nancy-fraser-taylor-francis-inc-9780815363644-jill-blackmore</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815363644.jpg?v=1767770749</image:loc>
      <image:title>Educational Leadership and Nancy Fraser</image:title>
      <image:caption>Book cover of: Educational Leadership and Nancy Fraser. By: Jill Blackmore</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unterbringung-in-einem-psychiatrischen-krankenhaus-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631442524-eine-untersuchung-zur-dauer-der-unterbringung-und-zu-ihrer-rechtfertigung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631442524.jpg?v=1767770749</image:loc>
      <image:title>Die Unterbringung in einem psychiatrischen Krankenhaus</image:title>
      <image:caption>Book cover of: Die Unterbringung in einem psychiatrischen Krankenhaus</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-interventions-for-refugee-children-taylor-francis-ltd-9780415308243-theoretical-perspectives-and-implementing-best-practice</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415308243.jpg?v=1767770750</image:loc>
      <image:title>Educational Interventions for Refugee Children</image:title>
      <image:caption>Book cover of: Educational Interventions for Refugee Children</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-untersagung-von-parallelimport-beschraenkungen-durch-eg-kommission-und-eugh-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631480137</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631480137.jpg?v=1767770750</image:loc>
      <image:title>Die Untersagung von Parallelimport-Beschraenkungen durch EG-Kommission und EuGH</image:title>
      <image:caption>Book cover of: Die Untersagung von Parallelimport-Beschraenkungen durch EG-Kommission und EuGH</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-inequalities-taylor-francis-ltd-9780415539982-difference-and-diversity-in-schools-and-higher-education-kalwant-bhopal</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415539982.jpg?v=1767770748</image:loc>
      <image:title>Educational Inequalities</image:title>
      <image:caption>Book cover of: Educational Inequalities. By: Kalwant Bhopal</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-imperative-taylor-francis-ltd-9780750703338-a-defence-of-socratic-and-aesthetic-learning</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750703338.jpg?v=1767770750</image:loc>
      <image:title>Educational Imperative</image:title>
      <image:caption>Book cover of: Educational Imperative</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-ideas-of-charles-fourier-1772-1837-taylor-francis-ltd-9781138968431-david-zeldin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138968431.jpg?v=1767770750</image:loc>
      <image:title>Educational Ideas of Charles Fourier 1772-1837</image:title>
      <image:caption>Book cover of: Educational Ideas of Charles Fourier 1772-1837. By: David Zeldin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-judgments-international-library-of-the-philosophy-of-education-volume-9-taylor-francis-ltd-9780415565721-papers-in-the-philosophy-of-education</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415565721.jpg?v=1767770751</image:loc>
      <image:title>Educational Judgments (International Library of the Philosophy of Education Volume 9)</image:title>
      <image:caption>Book cover of: Educational Judgments (International Library of the Philosophy of Education Volume 9)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leader-s-guide-for-school-scheduling-taylor-francis-ltd-9781138207424-strategies-addressing-grades-k-12-elliott-merenbloom</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138207424.jpg?v=1767770750</image:loc>
      <image:title>Educational Leader&apos;s Guide for School Scheduling</image:title>
      <image:caption>Book cover of: Educational Leader&apos;s Guide for School Scheduling. By: Elliott Merenbloom</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-futures-taylor-francis-ltd-9780415603638-dominant-and-contesting-visions-ivana-milojevic</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415603638.jpg?v=1767770751</image:loc>
      <image:title>Educational Futures</image:title>
      <image:caption>Book cover of: Educational Futures. By: Ivana Milojevic</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-interventions-for-refugee-children-taylor-francis-ltd-9780415308250-theoretical-perspectives-and-implementing-best-practice</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415308250.jpg?v=1767770749</image:loc>
      <image:title>Educational Interventions for Refugee Children</image:title>
      <image:caption>Book cover of: Educational Interventions for Refugee Children</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unmittelbare-anwendbarkeit-der-voelkerrechtlichen-vertraege-der-eg-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631449820-die-eg-freihandels-und-assoziierungsvertraege-und-andere-gemeinschaftsabkommen-im-spannungsfeld-von-voelkerrecht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631449820.jpg?v=1767770748</image:loc>
      <image:title>Die unmittelbare Anwendbarkeit der voelkerrechtlichen Vertraege der EG</image:title>
      <image:caption>Book cover of: Die unmittelbare Anwendbarkeit der voelkerrechtlichen Vertraege der EG</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unkoordinierte-uebernahme-einer-aktiengesellschaft-nach-deutschem-recht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631459928</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631459928.jpg?v=1767770751</image:loc>
      <image:title>Die unkoordinierte Uebernahme einer Aktiengesellschaft nach deutschem Recht</image:title>
      <image:caption>Book cover of: Die unkoordinierte Uebernahme einer Aktiengesellschaft nach deutschem Recht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-goods-the-university-of-chicago-press-9780226514031-values-evidence-and-decision-making-harry-brighouse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226514031.jpg?v=1767770752</image:loc>
      <image:title>Educational Goods</image:title>
      <image:caption>Book cover of: Educational Goods. By: Harry Brighouse</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-sage-publications-inc-9780761967774-personal-growth-for-professional-development-harry-tomlinson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761967774.jpg?v=1767770751</image:loc>
      <image:title>Educational Leadership</image:title>
      <image:caption>Book cover of: Educational Leadership. By: Harry Tomlinson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-ideas-of-charles-fourier-taylor-francis-ltd-9780367142759-1772-1837-david-zeldin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367142759.jpg?v=1767770752</image:loc>
      <image:title>Educational Ideas of Charles Fourier</image:title>
      <image:caption>Book cover of: Educational Ideas of Charles Fourier. By: David Zeldin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ungarische-wirtschaftsordnung-heute-peter-lang-international-academic-publishers-9783261032287</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261032287.jpg?v=1767770750</image:loc>
      <image:title>Die ungarische Wirtschaftsordnung heute</image:title>
      <image:caption>Book cover of: Die ungarische Wirtschaftsordnung heute</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-ideas-of-charles-fourier-1772-1837-taylor-francis-ltd-9780714614519</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780714614519.jpg?v=1767770752</image:loc>
      <image:title>Educational Ideas of Charles Fourier 1772-1837</image:title>
      <image:caption>Book cover of: Educational Ideas of Charles Fourier 1772-1837</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-untersuchungskompetenzen-des-amerikanischen-kongresses-peter-lang-international-academic-publishers-9783261000637-ferdinand-meyer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261000637.jpg?v=1767770753</image:loc>
      <image:title>Die Untersuchungskompetenzen des amerikanischen Kongresses</image:title>
      <image:caption>Book cover of: Die Untersuchungskompetenzen des amerikanischen Kongresses. By: Ferdinand Meyer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-imperative-taylor-francis-ltd-9780750703321-a-defence-of-socratic-and-aesthetic-learning</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750703321.jpg?v=1767770750</image:loc>
      <image:title>Educational Imperative</image:title>
      <image:caption>Book cover of: Educational Imperative</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umweltpolitische-steuerungsfaehigkeit-der-europaeischen-gemeinschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631315958-eine-policy-analyse-der-richtlinie-ueber-die-umweltvertraeglichkeitspruefung-detlev-albert</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631315958.jpg?v=1767770752</image:loc>
      <image:title>Die umweltpolitische Steuerungsfaehigkeit der Europaeischen Gemeinschaft</image:title>
      <image:caption>Book cover of: Die umweltpolitische Steuerungsfaehigkeit der Europaeischen Gemeinschaft. By: Detlev Albert</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unfaehigkeit-des-erwachsenen-patienten-zur-einwilligung-in-den-aerztlichen-eingriff-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631469033-zugleich-eine-besprechung-des-sogenannten-zahnextraktionsfalles-bgh-njw-1978-1206</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631469033.jpg?v=1767770751</image:loc>
      <image:title>Die Unfaehigkeit des erwachsenen Patienten zur Einwilligung in den aerztlichen Eingriff</image:title>
      <image:caption>Book cover of: Die Unfaehigkeit des erwachsenen Patienten zur Einwilligung in den aerztlichen Eingriff</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ungeloeste-nationale-frage-in-aethiopien-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820472189-studie-zu-den-befreiungsbewegungen-der-oromo-und-eritreas</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820472189.jpg?v=1767770750</image:loc>
      <image:title>Die ungeloeste nationale Frage in Aethiopien</image:title>
      <image:caption>Book cover of: Die ungeloeste nationale Frage in Aethiopien</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umwandlung-von-auslandsschulden-in-investitionen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631434659-rechtsgrundlagen-und-praxis-in-brasilien</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631434659.jpg?v=1767770751</image:loc>
      <image:title>Die Umwandlung von Auslandsschulden in Investitionen</image:title>
      <image:caption>Book cover of: Die Umwandlung von Auslandsschulden in Investitionen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umweltvorsorge-im-rahmen-der-landesplanung-nordrhein-westfalen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820476699-eine-integrationsorientierte-untersuchung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820476699.jpg?v=1767770751</image:loc>
      <image:title>Die Umweltvorsorge im Rahmen der Landesplanung Nordrhein-Westfalen</image:title>
      <image:caption>Book cover of: Die Umweltvorsorge im Rahmen der Landesplanung Nordrhein-Westfalen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unberechtigte-wettbewerbsrechtliche-abmahnung-unter-besonderer-beruecksichtigung-der-unberechtigten-schutzrechtsverwarnung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820483161</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820483161.jpg?v=1767770754</image:loc>
      <image:title>Die unberechtigte wettbewerbsrechtliche Abmahnung unter besonderer Beruecksichtigung der unberechtigten Schutzrechtsverwarnung</image:title>
      <image:caption>Book cover of: Die unberechtigte wettbewerbsrechtliche Abmahnung unter besonderer Beruecksichtigung der unberechtigten Schutzrechtsverwarnung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unbenannte-zuwendung-im-privatrechtssystem-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631430750</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631430750.jpg?v=1767770751</image:loc>
      <image:title>Die unbenannte Zuwendung im Privatrechtssystem</image:title>
      <image:caption>Book cover of: Die unbenannte Zuwendung im Privatrechtssystem</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-experiences-of-hidden-homeless-teenagers-taylor-francis-ltd-9780415893725-living-doubled-up-ronald-e-hallett</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415893725.jpg?v=1767770751</image:loc>
      <image:title>Educational Experiences of Hidden Homeless Teenagers</image:title>
      <image:caption>Book cover of: Educational Experiences of Hidden Homeless Teenagers. By: Ronald E. Hallett</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umsetzung-der-himmelfahrt-christi-in-die-zeichenhafte-liturgie-peter-lang-international-academic-publishers-9783261037305</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261037305.jpg?v=1767770751</image:loc>
      <image:title>Die Umsetzung der Himmelfahrt Christi in die zeichenhafte Liturgie</image:title>
      <image:caption>Book cover of: Die Umsetzung der Himmelfahrt Christi in die zeichenhafte Liturgie</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umweltschutzsubvention-im-gemeinschaftsrecht-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906769363-eine-umweltrechtliche-kritik-der-europaeischen-beihilfekontrolle-joelle-sepibus</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906769363.jpg?v=1767770751</image:loc>
      <image:title>Die Umweltschutzsubvention im Gemeinschaftsrecht</image:title>
      <image:caption>Book cover of: Die Umweltschutzsubvention im Gemeinschaftsrecht. By: Joelle Sepibus</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-unabhaengigkeit-als-konstitutives-element-im-koalitionsverfassungs-und-tarifvertragsrecht-peter-lang-ag-9783631351444</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631351444.jpg?v=1767770752</image:loc>
      <image:title>Die Unabhaengigkeit ALS Konstitutives Element Im Koalitionsverfassungs- Und Tarifvertragsrecht</image:title>
      <image:caption>Book cover of: Die Unabhaengigkeit ALS Konstitutives Element Im Koalitionsverfassungs- Und Tarifvertragsrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-equity-and-accountability-taylor-francis-ltd-9780415945066-paradigms-policies-and-politics-linda-skrla</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415945066.jpg?v=1767770750</image:loc>
      <image:title>Educational Equity and Accountability</image:title>
      <image:caption>Book cover of: Educational Equity and Accountability. By: Linda Skrla</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umsetzung-von-eg-richtlinien-im-privatrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631352236</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631352236.jpg?v=1767770751</image:loc>
      <image:title>Die Umsetzung von EG-Richtlinien im Privatrecht</image:title>
      <image:caption>Book cover of: Die Umsetzung von EG-Richtlinien im Privatrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-futures-taylor-francis-ltd-9780415333740-dominant-and-contesting-visions-i-milojevic</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415333740.jpg?v=1767770754</image:loc>
      <image:title>Educational Futures</image:title>
      <image:caption>Book cover of: Educational Futures. By: I. Milojevic</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-and-hannah-arendt-taylor-francis-ltd-9780415820028-helen-m-gunter</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415820028.jpg?v=1767770750</image:loc>
      <image:title>Educational Leadership and Hannah Arendt</image:title>
      <image:caption>Book cover of: Educational Leadership and Hannah Arendt. By: Helen M. Gunter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umsetzung-der-bestimmungen-ueber-die-europaeische-waehrungsunion-in-das-deutsche-verfassungsrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631366226-eine-untersuchung-nach-dem-vertrag-von-maastricht-unter-besonderer-beruecksichtig</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631366226.jpg?v=1767770752</image:loc>
      <image:title>Die Umsetzung der Bestimmungen ueber die Europaeische Waehrungsunion in das deutsche Verfassungsrecht</image:title>
      <image:caption>Book cover of: Die Umsetzung der Bestimmungen ueber die Europaeische Waehrungsunion in das deutsche Verfassungsrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-evaluation-assessment-and-monitoring-taylor-francis-ltd-9780415447805-a-systematic-approach-cees-glas</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415447805.jpg?v=1767770753</image:loc>
      <image:title>Educational Evaluation, Assessment and Monitoring</image:title>
      <image:caption>Book cover of: Educational Evaluation, Assessment and Monitoring. By: Cees Glas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umweltvertraeglichkeitspruefung-in-deutschland-und-der-schweiz-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631322284-verfassungsrechtliche-herleitung-und-rechtsvergleich</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631322284.jpg?v=1767770751</image:loc>
      <image:title>Die Umweltvertraeglichkeitspruefung in Deutschland und der Schweiz</image:title>
      <image:caption>Book cover of: Die Umweltvertraeglichkeitspruefung in Deutschland und der Schweiz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-equity-taylor-francis-inc-9780815325185</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815325185.jpg?v=1767770753</image:loc>
      <image:title>Educational Equity</image:title>
      <image:caption>Book cover of: Educational Equity</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umsetzung-der-europaeischen-uebereinkommen-von-rom-und-bruessel-in-das-recht-der-mitgliedstaaten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631321706-dargestellt-am-beispiel-deutschlands-und-daenemarks</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631321706.jpg?v=1767770752</image:loc>
      <image:title>Die Umsetzung der europaeischen Uebereinkommen von Rom und Bruessel in das Recht der Mitgliedstaaten</image:title>
      <image:caption>Book cover of: Die Umsetzung der europaeischen Uebereinkommen von Rom und Bruessel in das Recht der Mitgliedstaaten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-effectiveness-theory-taylor-francis-ltd-9780367109462-further-developments-in-a-multilevel-context-katharina-maag-merki</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367109462.jpg?v=1767770752</image:loc>
      <image:title>Educational Effectiveness Theory</image:title>
      <image:caption>Book cover of: Educational Effectiveness Theory. By: Katharina Maag Merki</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-economics-bloomsbury-publishing-plc-9780877667643-where-do-school-funds-go-marguerite-roza</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780877667643.jpg?v=1767770751</image:loc>
      <image:title>Educational Economics</image:title>
      <image:caption>Book cover of: Educational Economics. By: Marguerite Roza</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-leadership-sage-publications-inc-9780761967767-personal-growth-for-professional-development-harry-tomlinson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761967767.jpg?v=1767770750</image:loc>
      <image:title>Educational Leadership</image:title>
      <image:caption>Book cover of: Educational Leadership. By: Harry Tomlinson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umwandlung-von-kapitalgesellschaften-in-personenunternehmen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820457391-zur-diskussion-um-die-gestaltung-eines-betriebswirtschaftlich-optimalen-umwandlungsteuergesetzes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820457391.jpg?v=1767770753</image:loc>
      <image:title>Die Umwandlung von Kapitalgesellschaften in Personenunternehmen</image:title>
      <image:caption>Book cover of: Die Umwandlung von Kapitalgesellschaften in Personenunternehmen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umsetzung-des-internationalen-paktes-ueber-wirtschaftliche-soziale-und-kulturelle-rechte-vom-19-dezember-1966-in-die-rechtsordnung-der-bundesrepublik-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631422205</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631422205.jpg?v=1767770751</image:loc>
      <image:title>Die Umsetzung des Internationalen Paktes ueber wirtschaftliche, soziale und kulturelle Rechte vom 19. Dezember 1966 in die Rechtsordnung der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Umsetzung des Internationalen Paktes ueber wirtschaftliche, soziale und kulturelle Rechte vom 19. Dezember 1966 in die Rechtsordnung der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-differences-rle-edu-l-taylor-francis-ltd-9780415506243-arthur-jensen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415506243.jpg?v=1767770750</image:loc>
      <image:title>Educational Differences (RLE Edu L)</image:title>
      <image:caption>Book cover of: Educational Differences (RLE Edu L). By: Arthur Jensen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-equity-and-accountability-taylor-francis-ltd-9780415945059-paradigms-policies-and-politics-linda-skrla</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415945059.jpg?v=1767770752</image:loc>
      <image:title>Educational Equity and Accountability</image:title>
      <image:caption>Book cover of: Educational Equity and Accountability. By: Linda Skrla</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-dialogues-taylor-francis-ltd-9780415462167-understanding-and-promoting-productive-interaction</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415462167.jpg?v=1767770753</image:loc>
      <image:title>Educational Dialogues</image:title>
      <image:caption>Book cover of: Educational Dialogues</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-experience-as-lived-knowledge-history-alterity-taylor-francis-ltd-9781138804999-the-selected-works-of-william-f-pinar-william-f-pinar</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138804999.jpg?v=1767770752</image:loc>
      <image:title>Educational Experience as Lived: Knowledge, History, Alterity</image:title>
      <image:caption>Book cover of: Educational Experience as Lived: Knowledge, History, Alterity. By: William F. Pinar</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ueberwachung-betrieblicher-routinetaetigkeiten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820490671-ein-erklaerungs-und-entscheidungsmodell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820490671.jpg?v=1767770753</image:loc>
      <image:title>Die Ueberwachung betrieblicher Routinetaetigkeiten</image:title>
      <image:caption>Book cover of: Die Ueberwachung betrieblicher Routinetaetigkeiten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ultralinke-opposition-der-kpd-in-der-weimarer-republik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820453850-zur-geschichte-und-theorie-der-kpd-opposition-linke-kpd-der-entschiedenen-linken-der-gruppe-kommunistische-politik-und-des-d</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820453850.jpg?v=1767770751</image:loc>
      <image:title>Die ultralinke Opposition der KPD in der Weimarer Republik</image:title>
      <image:caption>Book cover of: Die ultralinke Opposition der KPD in der Weimarer Republik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-development-through-information-and-communications-technology-kogan-page-ltd-9780749435653</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780749435653.jpg?v=1767770752</image:loc>
      <image:title>Educational Development Through Information and Communications Technology</image:title>
      <image:caption>Book cover of: Educational Development Through Information and Communications Technology</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ueberwindung-von-orientierungskrisen-und-innovationsschwaechen-peter-lang-international-academic-publishers-9783261039316-eine-auseinandersetzung-mit-grundlagentheoretischen-problemstellungen-zur-erarbeitung-von-loesungskonzepten</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261039316.jpg?v=1767770752</image:loc>
      <image:title>Die Ueberwindung von Orientierungskrisen und Innovationsschwaechen</image:title>
      <image:caption>Book cover of: Die Ueberwindung von Orientierungskrisen und Innovationsschwaechen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-design-research-taylor-francis-ltd-9780415396349-van-den-aker-et</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415396349.jpg?v=1767770752</image:loc>
      <image:title>Educational Design Research</image:title>
      <image:caption>Book cover of: Educational Design Research. By: Van Den Aker/Et</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-united-nations-joint-inspection-unit-als-instrument-zur-einfuehrung-organisatorischer-rationalitaet-in-internationalen-organisationen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631342671</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631342671.jpg?v=1767770752</image:loc>
      <image:title>Die United Nations Joint Inspection Unit als Instrument zur Einfuehrung organisatorischer Rationalitaet in internationalen Organisationen</image:title>
      <image:caption>Book cover of: Die United Nations Joint Inspection Unit als Instrument zur Einfuehrung organisatorischer Rationalitaet in internationalen Organisationen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-uebertragung-von-aufgaben-auf-arbeitsgruppen-gemae-28a-betrvg-peter-lang-ag-9783631560747-unter-besonderer-beruecksichtigung-der-foerderungspflicht-aus-75-abs-2-satz-2-betrvg-anne-pfister</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631560747.jpg?v=1767770752</image:loc>
      <image:title>Die Uebertragung Von Aufgaben Auf Arbeitsgruppen Gemaeß § 28a Betrvg</image:title>
      <image:caption>Book cover of: Die Uebertragung Von Aufgaben Auf Arbeitsgruppen Gemaeß § 28a Betrvg. By: Anne Pfister</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-ecologies-bloomsbury-publishing-plc-9780739198971-toward-a-symbolic-material-understanding-of-discourse-technology-and-education-john-dowd</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780739198971.jpg?v=1767770753</image:loc>
      <image:title>Educational Ecologies</image:title>
      <image:caption>Book cover of: Educational Ecologies. By: John Dowd</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-delusions-university-of-california-press-9780520274747-why-choice-can-deepen-inequality-and-how-to-make-schools-fair-gary-orfield</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780520274747.jpg?v=1767770752</image:loc>
      <image:title>Educational Delusions?</image:title>
      <image:caption>Book cover of: Educational Delusions?. By: Gary Orfield</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-days-out-taylor-francis-ltd-9781138164291-a-handbook-for-teachers-planning-a-school-trip-green-christine</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138164291.jpg?v=1767770751</image:loc>
      <image:title>Educational Days Out</image:title>
      <image:caption>Book cover of: Educational Days Out. By: Green Christine</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-uebertragung-privaten-grundbesitzes-im-wege-vorweggenommener-erbfolge-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631326732-eine-analyse-der-steuerlichen-folgen-verschiedener-gestaltungsformen-vor-und-nach-der-reform-des-erbschaftste</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631326732.jpg?v=1767770752</image:loc>
      <image:title>Die Uebertragung privaten Grundbesitzes im Wege vorweggenommener Erbfolge</image:title>
      <image:caption>Book cover of: Die Uebertragung privaten Grundbesitzes im Wege vorweggenommener Erbfolge</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-differences-rle-edu-l-taylor-francis-ltd-9781138008274-arthur-jensen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138008274.jpg?v=1767770754</image:loc>
      <image:title>Educational Differences (RLE Edu L)</image:title>
      <image:caption>Book cover of: Educational Differences (RLE Edu L). By: Arthur Jensen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-uebertragung-von-hoheitsrechten-auf-die-europaeischen-gemeinschaften-peter-lang-ag-9783631430361</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631430361.jpg?v=1767770750</image:loc>
      <image:title>Die Uebertragung Von Hoheitsrechten Auf Die Europaeischen Gemeinschaften</image:title>
      <image:caption>Book cover of: Die Uebertragung Von Hoheitsrechten Auf Die Europaeischen Gemeinschaften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-failure-and-working-class-white-children-in-britain-palgrave-macmillan-9780230553033-gillian-evans</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780230553033.jpg?v=1767770753</image:loc>
      <image:title>Educational Failure and Working Class White Children in Britain</image:title>
      <image:caption>Book cover of: Educational Failure and Working Class White Children in Britain. By: Gillian Evans</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-delusions-university-of-california-press-9780520274730-why-choice-can-deepen-inequality-and-how-to-make-schools-fair-gary-orfield</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780520274730.jpg?v=1767770753</image:loc>
      <image:title>Educational Delusions?</image:title>
      <image:caption>Book cover of: Educational Delusions?. By: Gary Orfield</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-dialogues-taylor-francis-ltd-9780415462150-understanding-and-promoting-productive-interaction</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415462150.jpg?v=1767770752</image:loc>
      <image:title>Educational Dialogues</image:title>
      <image:caption>Book cover of: Educational Dialogues</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-experiences-of-hidden-homeless-teenagers-taylor-francis-ltd-9780415893732-living-doubled-up-ronald-e-hallett</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415893732.jpg?v=1767770753</image:loc>
      <image:title>Educational Experiences of Hidden Homeless Teenagers</image:title>
      <image:caption>Book cover of: Educational Experiences of Hidden Homeless Teenagers. By: Ronald E. Hallett</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-design-research-taylor-francis-ltd-9780415396356-van-den-aker-et</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415396356.jpg?v=1767770752</image:loc>
      <image:title>Educational Design Research</image:title>
      <image:caption>Book cover of: Educational Design Research. By: Van Den Aker/Et</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umstellung-der-gesetzlichen-rentenversicherung-auf-ein-partiell-kapitalgedecktes-finanzierungsverfahren-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631436776-eine-simulationsanalyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631436776.jpg?v=1767770751</image:loc>
      <image:title>Die Umstellung der Gesetzlichen Rentenversicherung auf ein partiell kapitalgedecktes Finanzierungsverfahren</image:title>
      <image:caption>Book cover of: Die Umstellung der Gesetzlichen Rentenversicherung auf ein partiell kapitalgedecktes Finanzierungsverfahren</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-days-out-taylor-francis-ltd-9780749426897-a-handbook-for-teachers-planning-a-school-trip-christin-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780749426897.jpg?v=1767770755</image:loc>
      <image:title>Educational Days Out</image:title>
      <image:caption>Book cover of: Educational Days Out. By: Christin Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ueberwindung-der-elegischen-liebe-bei-properz-buch-i-iii-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820473889</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820473889.jpg?v=1767770754</image:loc>
      <image:title>Die Ueberwindung der elegischen Liebe bei Properz (Buch I-III)</image:title>
      <image:caption>Book cover of: Die Ueberwindung der elegischen Liebe bei Properz (Buch I-III)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-uebertragbarkeit-von-werbekonzeptionen-auf-internationale-maerkte-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820469868-analyse-und-exploration-auf-der-grundlage-einer-befragung-bei-europaweit-taetigen-werbeagenturen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-choices-transitions-and-aspirations-in-europe-taylor-francis-ltd-9781138104037-systemic-institutional-and-subjective-challenges-aina-tarabini</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138104037.jpg?v=1767770752</image:loc>
      <image:title>Educational Choices, Transitions and Aspirations in Europe</image:title>
      <image:caption>Book cover of: Educational Choices, Transitions and Aspirations in Europe. By: Aina Tarabini</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-dilemmas-taylor-francis-ltd-9781138125605-a-cultural-psychological-perspective-luca-tateo</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138125605.jpg?v=1767770753</image:loc>
      <image:title>Educational Dilemmas</image:title>
      <image:caption>Book cover of: Educational Dilemmas. By: Luca Tateo</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umsatzsteuerrechtliche-behandlung-von-abfindungszahlungen-bei-vertragsaufloesung-peter-lang-ag-9783631393635</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631393635.jpg?v=1767770753</image:loc>
      <image:title>Die Umsatzsteuerrechtliche Behandlung Von Abfindungszahlungen Bei Vertragsaufloesung</image:title>
      <image:caption>Book cover of: Die Umsatzsteuerrechtliche Behandlung Von Abfindungszahlungen Bei Vertragsaufloesung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-umrechnung-der-jahresabschluesse-auslaendischer-tochterunternehmen-fuer-den-weltabschluss-in-der-eg-unter-dem-aspekt-seiner-informationsfunktion-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820413922</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820413922.jpg?v=1767770753</image:loc>
      <image:title>Die Umrechnung der Jahresabschluesse auslaendischer Tochterunternehmen fuer den Weltabschluss in der EG unter dem Aspekt seiner Informationsfunktion</image:title>
      <image:caption>Book cover of: Die Umrechnung der Jahresabschluesse auslaendischer Tochterunternehmen fuer den Weltabschluss in der EG unter dem Aspekt seiner Informationsfunktion</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-uebertragbarkeit-der-deutschen-wiedervereinigungsmodelle-auf-das-geteilte-korea-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631449646</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631449646.jpg?v=1767770754</image:loc>
      <image:title>Die Uebertragbarkeit der deutschen Wiedervereinigungsmodelle auf das geteilte Korea</image:title>
      <image:caption>Book cover of: Die Uebertragbarkeit der deutschen Wiedervereinigungsmodelle auf das geteilte Korea</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-binds-of-poverty-taylor-francis-ltd-9781138291119-the-lives-of-school-children-ceri-brown</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138291119.jpg?v=1767770754</image:loc>
      <image:title>Educational Binds of Poverty</image:title>
      <image:caption>Book cover of: Educational Binds of Poverty. By: Ceri Brown</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ueberwindung-des-traditionellen-frauenbildes-im-werk-anton-cechovs-1886-1903-peter-lang-ag-9783631440421</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631440421.jpg?v=1767770753</image:loc>
      <image:title>Die Ueberwindung Des Traditionellen Frauenbildes Im Werk Anton Cechovs (1886-1903)</image:title>
      <image:caption>Book cover of: Die Ueberwindung Des Traditionellen Frauenbildes Im Werk Anton Cechovs (1886-1903)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ulmer-katholiken-im-zeitalter-der-glaubenskaempfe-lebensbedingungen-einer-konfessionellen-minderheit-peter-lang-international-academic-publishers-9783261029638-lebensbedingungen-einer-konfessionellen-minderheit</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261029638.jpg?v=1767770753</image:loc>
      <image:title>Die Ulmer Katholiken im Zeitalter der Glaubenskaempfe:- Lebensbedingungen einer konfessionellen Minderheit</image:title>
      <image:caption>Book cover of: Die Ulmer Katholiken im Zeitalter der Glaubenskaempfe:- Lebensbedingungen einer konfessionellen Minderheit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ueberschusssituation-auf-dem-getreidemarkt-der-europaeischen-gemeinschaft-und-alternativen-einer-zukuenftigen-getreidemarktpolitik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820455854</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820455854.jpg?v=1767770754</image:loc>
      <image:title>Die Ueberschusssituation auf dem Getreidemarkt der Europaeischen Gemeinschaft und Alternativen einer zukuenftigen Getreidemarktpolitik</image:title>
      <image:caption>Book cover of: Die Ueberschusssituation auf dem Getreidemarkt der Europaeischen Gemeinschaft und Alternativen einer zukuenftigen Getreidemarktpolitik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-computing-and-problem-solving-taylor-francis-inc-9780866567817</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780866567817.jpg?v=1767770753</image:loc>
      <image:title>Educational Computing and Problem Solving</image:title>
      <image:caption>Book cover of: Educational Computing and Problem Solving</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-change-and-the-secondary-school-music-curriculum-in-aotearoa-new-zealand-taylor-francis-ltd-9781138088849</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138088849.jpg?v=1767770754</image:loc>
      <image:title>Educational Change and the Secondary School Music Curriculum in Aotearoa New Zealand</image:title>
      <image:caption>Book cover of: Educational Change and the Secondary School Music Curriculum in Aotearoa New Zealand</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ueberpruefung-der-umweltvertraeglichkeit-von-bundesmassnahmen-im-amerikanischen-recht-peter-lang-international-academic-publishers-9783261030702-laurent-f-carrel</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261030702.jpg?v=1767770753</image:loc>
      <image:title>Die Ueberpruefung der Umweltvertraeglichkeit von Bundesmassnahmen im amerikanischen Recht</image:title>
      <image:caption>Book cover of: Die Ueberpruefung der Umweltvertraeglichkeit von Bundesmassnahmen im amerikanischen Recht. By: Laurent F. Carrel</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-assessment-evaluation-and-research-taylor-francis-ltd-9780415839075-the-selected-works-of-mary-e-james-mary-e-james</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415839075.jpg?v=1767770755</image:loc>
      <image:title>Educational Assessment, Evaluation and Research</image:title>
      <image:caption>Book cover of: Educational Assessment, Evaluation and Research. By: Mary E. James</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-charters-and-documents-598-to-1909-cambridge-university-press-9781108010160-arthur-f-leach</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781108010160.jpg?v=1767770754</image:loc>
      <image:title>Educational Charters and Documents 598 to 1909</image:title>
      <image:caption>Book cover of: Educational Charters and Documents 598 to 1909. By: Arthur F. Leach</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-attainments-taylor-francis-ltd-9781138080454-issues-and-outcomes-in-multicultural-education-gajendra-k-verma</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138080454.jpg?v=1767770754</image:loc>
      <image:title>Educational Attainments</image:title>
      <image:caption>Book cover of: Educational Attainments. By: Gajendra K. Verma</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ueber-die-haftsumme-des-171-hgb-hinausgehende-kommanditistenhaftung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820472363</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820472363.jpg?v=1767770754</image:loc>
      <image:title>Die ueber die Haftsumme des  171 HGB hinausgehende Kommanditistenhaftung</image:title>
      <image:caption>Book cover of: Die ueber die Haftsumme des  171 HGB hinausgehende Kommanditistenhaftung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ueberschuldung-privater-als-problem-von-ungleichgewichten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631325209</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631325209.jpg?v=1767770754</image:loc>
      <image:title>Die Ueberschuldung Privater als Problem von Ungleichgewichten</image:title>
      <image:caption>Book cover of: Die Ueberschuldung Privater als Problem von Ungleichgewichten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-assessment-in-latin-america-taylor-francis-inc-9780815367512-sue-swaffield</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815367512.jpg?v=1767770753</image:loc>
      <image:title>Educational Assessment in Latin America</image:title>
      <image:caption>Book cover of: Educational Assessment in Latin America. By: Sue Swaffield</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-architecture-in-ohio-kent-state-university-press-9780873386661-from-one-room-schools-and-carnegie-libraries-to-community-education-villages-virginia-e-mccormick</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780873386661.jpg?v=1767770754</image:loc>
      <image:title>Educational Architecture in Ohio</image:title>
      <image:caption>Book cover of: Educational Architecture in Ohio. By: Virginia E. McCormick</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-assessment-john-wiley-sons-inc-9780471472483-a-practical-introduction-thomas-p-hogan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780471472483.jpg?v=1767770755</image:loc>
      <image:title>Educational Assessment</image:title>
      <image:caption>Book cover of: Educational Assessment. By: Thomas P. Hogan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-assessment-evaluation-and-research-taylor-francis-ltd-9780415816793-the-selected-works-of-mary-e-james-mary-e-james</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415816793.jpg?v=1767770756</image:loc>
      <image:title>Educational Assessment, Evaluation and Research</image:title>
      <image:caption>Book cover of: Educational Assessment, Evaluation and Research. By: Mary E. James</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-u-s-amerikanische-deregulation-policy-im-luftverkehrs-und-bankenbereich-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820415070</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820415070.jpg?v=1767770754</image:loc>
      <image:title>Die U.S.-amerikanische Deregulation Policy im Luftverkehrs- und Bankenbereich</image:title>
      <image:caption>Book cover of: Die U.S.-amerikanische Deregulation Policy im Luftverkehrs- und Bankenbereich</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-attainments-taylor-francis-ltd-9781138071322-issues-and-outcomes-in-multicultural-education-gajendra-k-verma</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138071322.jpg?v=1767770753</image:loc>
      <image:title>Educational Attainments</image:title>
      <image:caption>Book cover of: Educational Attainments. By: Gajendra K. Verma</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-administration-and-history-taylor-francis-ltd-9781138993358-the-state-of-the-field-tanya-fitzgerald</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138993358.jpg?v=1767770753</image:loc>
      <image:title>Educational Administration and History</image:title>
      <image:caption>Book cover of: Educational Administration and History. By: Tanya Fitzgerald</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-uebernahme-staatlicher-gewaehrleistungen-in-der-bundesrepublik-deutschland-peter-lang-ag-9783631357002</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631357002.jpg?v=1767770756</image:loc>
      <image:title>Die Uebernahme Staatlicher Gewaehrleistungen in Der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Uebernahme Staatlicher Gewaehrleistungen in Der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-uebernahme-von-aktien-fuer-rechnung-der-gesellschaft-peter-lang-ag-9783631541357-eine-untersuchung-zu-56-abs-3-aktg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631541357.jpg?v=1767770755</image:loc>
      <image:title>Die Uebernahme Von Aktien Fuer Rechnung Der Gesellschaft</image:title>
      <image:caption>Book cover of: Die Uebernahme Von Aktien Fuer Rechnung Der Gesellschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ueberpruefung-der-lernziele-des-englischunterrichts-fuer-die-7-und-8-jahrgangsstufe-der-hauptschule-in-informellen-schriftlichen-tests-und-die-gewichtung-der-schuelerleistungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820487664-ei</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820487664.jpg?v=1767770754</image:loc>
      <image:title>Die Ueberpruefung der Lernziele des Englischunterrichts fuer die 7. und 8. Jahrgangsstufe der Hauptschule in informellen, schriftlichen Tests und die Gewichtung der Schuelerleistungen</image:title>
      <image:caption>Book cover of: Die Ueberpruefung der Lernziele des Englischunterrichts fuer die 7. und 8. Jahrgangsstufe der Hauptschule in informellen, schriftlichen Tests und die Gewichtung der Schuelerleistungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tuerkei-auf-dem-weg-in-die-moderne-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820499933-bildung-politik-und-wirtschaft-vom-osmanischen-reich-bis-heute</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820499933.jpg?v=1767770754</image:loc>
      <image:title>Die Tuerkei auf dem Weg in die Moderne</image:title>
      <image:caption>Book cover of: Die Tuerkei auf dem Weg in die Moderne</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-approaches-to-internationalization-through-intercultural-dialogue-taylor-francis-ltd-9780367001469-reflections-on-theory-and-practice-paloma-castro</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367001469.jpg?v=1767770754</image:loc>
      <image:title>Educational Approaches to Internationalization through Intercultural Dialogue</image:title>
      <image:caption>Book cover of: Educational Approaches to Internationalization through Intercultural Dialogue. By: Paloma Castro</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-approaches-to-internationalization-through-intercultural-dialogue-taylor-francis-ltd-9780367001438-reflections-on-theory-and-practice-paloma-castro</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367001438.jpg?v=1767770755</image:loc>
      <image:title>Educational Approaches to Internationalization through Intercultural Dialogue</image:title>
      <image:caption>Book cover of: Educational Approaches to Internationalization through Intercultural Dialogue. By: Paloma Castro</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-ueberpruefbarkeit-der-betriebsfremden-privatentnahme-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631439760-zur-funktionalitaet-und-funktionsreinheit-des-selbstbedienungsgrohandels</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631439760.jpg?v=1767770753</image:loc>
      <image:title>Die Ueberpruefbarkeit der betriebsfremden Privatentnahme</image:title>
      <image:caption>Book cover of: Die Ueberpruefbarkeit der betriebsfremden Privatentnahme</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tschechischen-kontaktwoerter-in-der-slovakischen-sprachpraxis-und-in-der-zeitgenoessischen-slovakistik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876909035</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876909035.jpg?v=1767770753</image:loc>
      <image:title>Die tschechischen Kontaktwoerter in der slovakischen Sprachpraxis und in der zeitgenoessischen Slovakistik</image:title>
      <image:caption>Book cover of: Die tschechischen Kontaktwoerter in der slovakischen Sprachpraxis und in der zeitgenoessischen Slovakistik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-trichotomie-des-allgemeinen-verwaltungsrechts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631496220</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631496220.jpg?v=1767770754</image:loc>
      <image:title>Die Trichotomie des Allgemeinen Verwaltungsrechts</image:title>
      <image:caption>Book cover of: Die Trichotomie des Allgemeinen Verwaltungsrechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tyrannei-der-bilder-sam-shepards-dramen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631425817</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631425817.jpg?v=1767770755</image:loc>
      <image:title>Die Tyrannei der Bilder - Sam Shepards Dramen</image:title>
      <image:caption>Book cover of: Die Tyrannei der Bilder - Sam Shepards Dramen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-treuhandanstalt-im-system-des-deutschen-gesellschafts-und-konzernrechts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631355824-zugleich-ein-beitrag-zur-konzernrechtlichen-erfassung-oeffentlicher-unternehmen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631355824.jpg?v=1767770754</image:loc>
      <image:title>Die Treuhandanstalt im System des deutschen Gesellschafts- und Konzernrechts</image:title>
      <image:caption>Book cover of: Die Treuhandanstalt im System des deutschen Gesellschafts- und Konzernrechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-treuepflicht-des-aktionaers-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631306215</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631306215.jpg?v=1767770755</image:loc>
      <image:title>Die Treuepflicht des Aktionaers</image:title>
      <image:caption>Book cover of: Die Treuepflicht des Aktionaers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-and-developmental-aspects-of-deafness-gallaudet-university-press-u-s-9780930323523</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780930323523.jpg?v=1767770758</image:loc>
      <image:title>Educational and Developmental Aspects of Deafness</image:title>
      <image:caption>Book cover of: Educational and Developmental Aspects of Deafness</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-change-in-international-early-childhood-contexts-taylor-francis-ltd-9780415732635-crossing-borders-of-reflection-linda-r-kroll</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415732635.jpg?v=1767770754</image:loc>
      <image:title>Educational Change in International Early Childhood Contexts</image:title>
      <image:caption>Book cover of: Educational Change in International Early Childhood Contexts. By: Linda R. Kroll</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-trennung-von-zivil-und-handelsrecht-unter-besonderer-beruecksichtigung-der-untersuchungs-und-ruegepflicht-nach-377-hgb-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820488531-eine-rechtsvergleichende-untersuchung-unter-einbeziehung-int</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820488531.jpg?v=1767770753</image:loc>
      <image:title>Die Trennung von Zivil- und Handelsrecht unter besonderer Beruecksichtigung der Untersuchungs- und Ruegepflicht nach  377 HGB</image:title>
      <image:caption>Book cover of: Die Trennung von Zivil- und Handelsrecht unter besonderer Beruecksichtigung der Untersuchungs- und Ruegepflicht nach  377 HGB</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-binds-of-poverty-taylor-francis-ltd-9780415719391-the-lives-of-school-children-ceri-brown</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415719391.jpg?v=1767770757</image:loc>
      <image:title>Educational Binds of Poverty</image:title>
      <image:caption>Book cover of: Educational Binds of Poverty. By: Ceri Brown</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-administration-and-leadership-taylor-francis-ltd-9781138825765-theoretical-foundations-david-burgess</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138825765.jpg?v=1767770754</image:loc>
      <image:title>Educational Administration and Leadership</image:title>
      <image:caption>Book cover of: Educational Administration and Leadership. By: David Burgess</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-administration-sage-publications-inc-9780803966093-a-decade-of-reform-joseph-f-murphy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780803966093.jpg?v=1767770758</image:loc>
      <image:title>Educational Administration</image:title>
      <image:caption>Book cover of: Educational Administration. By: Joseph F. Murphy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-treuhandanstalt-im-system-der-finanzverfassung-des-grundgesetzes-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631487532</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631487532.jpg?v=1767770754</image:loc>
      <image:title>Die Treuhandanstalt im System der Finanzverfassung des Grundgesetzes</image:title>
      <image:caption>Book cover of: Die Treuhandanstalt im System der Finanzverfassung des Grundgesetzes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-change-in-international-early-childhood-contexts-taylor-francis-ltd-9780415732628-crossing-borders-of-reflection-linda-r-kroll</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415732628.jpg?v=1767770755</image:loc>
      <image:title>Educational Change in International Early Childhood Contexts</image:title>
      <image:caption>Book cover of: Educational Change in International Early Childhood Contexts. By: Linda R. Kroll</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-typologie-des-kentauren-in-der-antiken-kunst-vom-10-bis-zum-ende-des-4-jahrhunderts-v-chr-peter-lang-international-academic-publishers-9783261017239</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261017239.jpg?v=1767770757</image:loc>
      <image:title>Die Typologie des Kentauren in der antiken Kunst vom 10. bis zum Ende des 4. Jahrhunderts v. Chr.</image:title>
      <image:caption>Book cover of: Die Typologie des Kentauren in der antiken Kunst vom 10. bis zum Ende des 4. Jahrhunderts v. Chr.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-assessment-and-evaluation-taylor-francis-ltd-9780415489720-harry-torrance</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415489720.jpg?v=1767770758</image:loc>
      <image:title>Educational Assessment and Evaluation</image:title>
      <image:caption>Book cover of: Educational Assessment and Evaluation. By: Harry Torrance</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-transformation-von-unternehmen-in-den-osteuropaeischen-staaten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631496572-eine-institutionenoekonomische-analyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631496572.jpg?v=1767770757</image:loc>
      <image:title>Die Transformation von Unternehmen in den osteuropaeischen Staaten</image:title>
      <image:caption>Book cover of: Die Transformation von Unternehmen in den osteuropaeischen Staaten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tuerkei-politik-griechenlands-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820456691-der-zypern-aegaeis-und-minderheitenkonflikt-aus-der-sicht-athens-1967-1982</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820456691.jpg?v=1767770758</image:loc>
      <image:title>Die Tuerkei-Politik Griechenlands</image:title>
      <image:caption>Book cover of: Die Tuerkei-Politik Griechenlands</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tuerkei-an-der-schwelle-zum-21-jahrhundert-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631307212-die-schoene-oder-der-kranke-mann-am-bosporus</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631307212.jpg?v=1767770756</image:loc>
      <image:title>Die Tuerkei an der Schwelle zum 21. Jahrhundert</image:title>
      <image:caption>Book cover of: Die Tuerkei an der Schwelle zum 21. Jahrhundert</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-administration-bloomsbury-publishing-plc-9780810846302-leading-with-mind-and-heart-robert-h-palestini</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780810846302.jpg?v=1767770755</image:loc>
      <image:title>Educational Administration</image:title>
      <image:caption>Book cover of: Educational Administration. By: Robert H. Palestini</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-and-vocational-books-taylor-francis-ltd-9780754602132-printed-writings-1641-1700-series-ii-part-one-volume-5-frances-teague</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780754602132.jpg?v=1767770755</image:loc>
      <image:title>Educational and Vocational Books</image:title>
      <image:caption>Book cover of: Educational and Vocational Books. By: Frances Teague</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-trennung-von-eigentum-und-verfuegungsgewalt-in-der-deutschen-publikums-aktiengesellschaft-und-der-funktionswandel-ihrer-organe-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631494820-eine-analyse-der-reformvorschlaege-unter-beruecksich</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631494820.jpg?v=1767770755</image:loc>
      <image:title>Die Trennung von Eigentum und Verfuegungsgewalt in der deutschen Publikums-Aktiengesellschaft und der Funktionswandel ihrer Organe</image:title>
      <image:caption>Book cover of: Die Trennung von Eigentum und Verfuegungsgewalt in der deutschen Publikums-Aktiengesellschaft und der Funktionswandel ihrer Organe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-administration-and-history-taylor-francis-ltd-9780415468879-the-state-of-the-field-fitzgerald-tanya-1st</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415468879.jpg?v=1767770755</image:loc>
      <image:title>Educational Administration and History</image:title>
      <image:caption>Book cover of: Educational Administration and History. By: Fitzgerald, Tanya, 1st</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-administration-in-a-pluralistic-society-state-university-of-new-york-press-9780791413746</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-administration-sage-publications-inc-9780803966086-a-decade-of-reform-joseph-f-murphy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780803966086.jpg?v=1767770757</image:loc>
      <image:title>Educational Administration</image:title>
      <image:caption>Book cover of: Educational Administration. By: Joseph F. Murphy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-todesstrafe-im-werk-carl-joseph-anton-mittermaiers-1787-1867-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631447222-zur-entwicklungsgeschichte-eines-werkbereichs-und-seiner-bedeutung-fuer-theorie-und-methodenbildung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631447222.jpg?v=1767770755</image:loc>
      <image:title>Die Todesstrafe im Werk Carl Joseph Anton Mittermaiers (1787-1867)</image:title>
      <image:caption>Book cover of: Die Todesstrafe im Werk Carl Joseph Anton Mittermaiers (1787-1867)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-trennung-von-tisch-bett-und-wohnung-cc-1128-1132-cic-und-das-herrenwort-mk-10-9-peter-lang-international-academic-publishers-9783261024633-eine-untersuchung-zur-theologie-und-geschichte-des-kirchlichen-ehetrennungsrechts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261024633.jpg?v=1767770756</image:loc>
      <image:title>Die Trennung von Tisch, Bett und Wohnung (cc. 1128-1132 Cic) und das Herrenwort Mk 10,9</image:title>
      <image:caption>Book cover of: Die Trennung von Tisch, Bett und Wohnung (cc. 1128-1132 Cic) und das Herrenwort Mk 10,9</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-accountability-effects-taylor-francis-inc-9780805897289-an-international-pespective-a-special-issue-of-the-peabody-journal-of-education</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805897289.jpg?v=1767770756</image:loc>
      <image:title>Educational Accountability Effects</image:title>
      <image:caption>Book cover of: Educational Accountability Effects</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-accountability-taylor-francis-ltd-9781138777897-international-perspectives-on-challenges-and-possibilities-for-school-leadership-jacob-easley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138777897.jpg?v=1767770756</image:loc>
      <image:title>Educational Accountability</image:title>
      <image:caption>Book cover of: Educational Accountability. By: Jacob Easley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-transmission-monetaerer-impulse-peter-lang-ag-9783631506806-eine-wirkungsanalyse-zentralbankpolitischer-ma-nahmen-im-lichte-unterschiedlicher-theoretischer-konzeptionen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631506806.jpg?v=1767770756</image:loc>
      <image:title>Die Transmission Monetaerer Impulse</image:title>
      <image:caption>Book cover of: Die Transmission Monetaerer Impulse</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tollwut-in-mitteleuropa-von-1953-bis-1966-springer-berlin-heidelberg-9783662304655-emil-kauker</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783662304655.jpg?v=1767770758</image:loc>
      <image:title>Die Tollwut in Mitteleuropa von 1953 bis 1966</image:title>
      <image:caption>Book cover of: Die Tollwut in Mitteleuropa von 1953 bis 1966. By: Emil Kauker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-activity-programs-for-older-adults-taylor-francis-inc-9780866562966-a-12-month-idea-guide-for-adult-education-instructors-and-activity-directors-in-gerontology</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780866562966.jpg?v=1767770757</image:loc>
      <image:title>Educational Activity Programs for Older Adults</image:title>
      <image:caption>Book cover of: Educational Activity Programs for Older Adults</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-transformation-des-russischen-bankensystems-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631305249-eine-analyse-im-lichte-der-agency-theorie</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631305249.jpg?v=1767770759</image:loc>
      <image:title>Die Transformation des russischen Bankensystems</image:title>
      <image:caption>Book cover of: Die Transformation des russischen Bankensystems</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tragweite-der-grundrechte-der-revidierten-preuischen-verfassung-vom-31-01-1850-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631445402</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631445402.jpg?v=1767770756</image:loc>
      <image:title>Die Tragweite der Grundrechte der revidierten preuischen Verfassung vom 31.01.1850</image:title>
      <image:caption>Book cover of: Die Tragweite der Grundrechte der revidierten preuischen Verfassung vom 31.01.1850</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tourismusindustrie-peter-lang-international-academic-publishers-9783261026378-eine-markt-und-wettbewerbsanalyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261026378.jpg?v=1767770757</image:loc>
      <image:title>Die Tourismusindustrie</image:title>
      <image:caption>Book cover of: Die Tourismusindustrie</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-thematik-und-der-stil-im-mespris-de-la-vie-et-consolation-contre-la-mort-von-jean-baptiste-chassignet-peter-lang-international-academic-publishers-9783261002068-heinz-wagner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261002068.jpg?v=1767770756</image:loc>
      <image:title>Die Thematik und der Stil im &apos;Mespris de la vie et consolation contre la mort&apos; von Jean-Baptiste Chassignet</image:title>
      <image:caption>Book cover of: Die Thematik und der Stil im &apos;Mespris de la vie et consolation contre la mort&apos; von Jean-Baptiste Chassignet. By: Heinz Wagner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-technology-power-state-university-of-new-york-press-9780791437988-educational-computing-as-a-social-practice-hank-bromley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-transatlantische-raumstationskooperation-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631450604-der-rechtliche-rahmen-einer-langfristigen-multinationalen-zusammenarbeit</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631450604.jpg?v=1767770756</image:loc>
      <image:title>Die transatlantische Raumstationskooperation</image:title>
      <image:caption>Book cover of: Die transatlantische Raumstationskooperation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-theorie-des-sektoralen-strukturwandels-peter-lang-international-academic-publishers-9783261032744-konzeptionelle-grundlegungen-probleme-und-neuere-theoretische-ansaetze-zur-erklaerung-des-sektoralen-strukturwandels</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261032744.jpg?v=1767770756</image:loc>
      <image:title>Die Theorie des sektoralen Strukturwandels</image:title>
      <image:caption>Book cover of: Die Theorie des sektoralen Strukturwandels</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/educational-access-and-social-justice-university-press-of-america-9780761845386-a-global-perspective-gowri-parameswaran</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761845386.jpg?v=1767770758</image:loc>
      <image:title>Educational Access and Social Justice</image:title>
      <image:caption>Book cover of: Educational Access and Social Justice. By: Gowri Parameswaran</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-textinhalte-in-den-grundschen-franzoesischlehrbuechern-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820467949-eine-fachdidaktische-untersuchung-von-lesestoffen-franzoesischer-sprachlehrbuecher-fuer-hoehere-schulen-in-deutschland-zwisc</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820467949.jpg?v=1767770757</image:loc>
      <image:title>Die Textinhalte in den Grundschen Franzoesischlehrbuechern</image:title>
      <image:caption>Book cover of: Die Textinhalte in den Grundschen Franzoesischlehrbuechern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-war-and-peace-institute-of-economic-affairs-9780255367462-the-surprising-success-of-private-schools-in-war-torn-countries-james-tooley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780255367462.jpg?v=1767770756</image:loc>
      <image:title>Education, War and Peace</image:title>
      <image:caption>Book cover of: Education, War and Peace. By: James Tooley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-theorie-erschoepfbarer-natuerlicher-ressourcen-bei-wachsender-bevoelkerung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820453157</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820453157.jpg?v=1767770758</image:loc>
      <image:title>Die Theorie erschoepfbarer natuerlicher Ressourcen bei wachsender Bevoelkerung</image:title>
      <image:caption>Book cover of: Die Theorie erschoepfbarer natuerlicher Ressourcen bei wachsender Bevoelkerung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-theorie-der-wirksamkeitsvoraussetzung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631449530</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631449530.jpg?v=1767770756</image:loc>
      <image:title>Die Theorie der Wirksamkeitsvoraussetzung</image:title>
      <image:caption>Book cover of: Die Theorie der Wirksamkeitsvoraussetzung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-thematisierungsfunktion-der-opposition-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631449356-die-parlamentarische-minderheit-des-deutschen-bundestags-als-innovative-kraft-im-politischen-system-der-bundesrepublik-deutschland</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631449356.jpg?v=1767770759</image:loc>
      <image:title>Die Thematisierungsfunktion der Opposition</image:title>
      <image:caption>Book cover of: Die Thematisierungsfunktion der Opposition</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-work-and-social-capital-taylor-francis-ltd-9780415204347-towards-a-new-conception-of-vocational-training-christoph-winch</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415204347.jpg?v=1767770758</image:loc>
      <image:title>Education, Work and Social Capital</image:title>
      <image:caption>Book cover of: Education, Work and Social Capital. By: Christoph Winch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-values-and-mind-international-library-of-the-philosophy-of-education-volume-6-taylor-francis-ltd-9780415647427-essays-for-r-s-peters</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415647427.jpg?v=1767770757</image:loc>
      <image:title>Education, Values and Mind (International Library of the Philosophy of Education Volume 6)</image:title>
      <image:caption>Book cover of: Education, Values and Mind (International Library of the Philosophy of Education Volume 6)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-these-vom-dinglichen-vertrag-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631432242-zur-formalen-struktur-der-eigentumsuebertragung-nach-929-satz-1-bgb</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631432242.jpg?v=1767770759</image:loc>
      <image:title>Die These vom dinglichen Vertrag</image:title>
      <image:caption>Book cover of: Die These vom dinglichen Vertrag</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-work-and-leisure-routledge-revivals-taylor-francis-ltd-9780415834940-harold-entwistle</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415834940.jpg?v=1767770759</image:loc>
      <image:title>Education, Work and Leisure (Routledge Revivals)</image:title>
      <image:caption>Book cover of: Education, Work and Leisure (Routledge Revivals). By: Harold Entwistle</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-theorie-der-bildung-im-werk-des-novalis-peter-lang-international-academic-publishers-9783261022561</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261022561.jpg?v=1767770758</image:loc>
      <image:title>Die Theorie der Bildung im Werk des Novalis</image:title>
      <image:caption>Book cover of: Die Theorie der Bildung im Werk des Novalis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-work-and-leisure-routledge-revivals-taylor-francis-ltd-9780415834971-harold-entwistle</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415834971.jpg?v=1767770757</image:loc>
      <image:title>Education, Work and Leisure (Routledge Revivals)</image:title>
      <image:caption>Book cover of: Education, Work and Leisure (Routledge Revivals). By: Harold Entwistle</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tradition-des-lyrischen-dramas-von-musset-bis-hofmannsthal-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820401448</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820401448.jpg?v=1767770761</image:loc>
      <image:title>Die Tradition des lyrischen Dramas von Musset bis Hofmannsthal</image:title>
      <image:caption>Book cover of: Die Tradition des lyrischen Dramas von Musset bis Hofmannsthal</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-traditionellen-personenverkehrsfreiheiten-des-eg-vertrages-und-das-aufenthaltsrecht-der-unionsbuerger-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631342480-eine-gegenueberstellung-der-vertraglichen-gewaehrleistungen-hermann-rothfuchs</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631342480.jpg?v=1767770758</image:loc>
      <image:title>Die traditionellen Personenverkehrsfreiheiten des EG-Vertrages und das Aufenthaltsrecht der Unionsbuerger</image:title>
      <image:caption>Book cover of: Die traditionellen Personenverkehrsfreiheiten des EG-Vertrages und das Aufenthaltsrecht der Unionsbuerger. By: Hermann Rothfuchs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-teufelsfiguren-der-mittelenglischen-dramen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631422908</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631422908.jpg?v=1767770759</image:loc>
      <image:title>Die Teufelsfiguren der mittelenglischen Dramen</image:title>
      <image:caption>Book cover of: Die Teufelsfiguren der mittelenglischen Dramen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-terrakottafiguren-von-myrina-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631309629-eine-untersuchung-ihrer-moeglichen-bedeutung-und-funktion-im-grabzusammenhang</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631309629.jpg?v=1767770759</image:loc>
      <image:title>Die Terrakottafiguren von Myrina</image:title>
      <image:caption>Book cover of: Die Terrakottafiguren von Myrina</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-training-and-the-future-of-work-i-taylor-francis-ltd-9780415202091-social-political-and-economic-contexts-of-policy-development-john-ahier</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415202091.jpg?v=1767770759</image:loc>
      <image:title>Education, Training and the Future of Work I</image:title>
      <image:caption>Book cover of: Education, Training and the Future of Work I. By: John Ahier</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-telefonnachfrage-peter-lang-international-academic-publishers-9783261015204-die-ausarbeitung-privater-hauptanschluesse-und-ihrer-prognose-fuer-ortsnetzbereiche</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261015204.jpg?v=1767770759</image:loc>
      <image:title>Die Telefonnachfrage</image:title>
      <image:caption>Book cover of: Die Telefonnachfrage</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tektonik-der-hellenen-edition-axel-menges-9783932565373-kontext-und-wirkung-der-architekturtheorie-von-karl-botticher-hartmut-mayer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783932565373.jpg?v=1767770759</image:loc>
      <image:title>Die Tektonik der Hellenen</image:title>
      <image:caption>Book cover of: Die Tektonik der Hellenen. By: Hartmut Mayer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tesla-revolution-wiley-vch-verlag-gmbh-9783527509454-wie-musk-co-unsere-zukunft-gestalten-willem-middelkoop</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783527509454.jpg?v=1767770760</image:loc>
      <image:title>Die Tesla-Revolution</image:title>
      <image:caption>Book cover of: Die Tesla-Revolution. By: Willem Middelkoop</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-values-and-mind-international-library-of-the-philosophy-of-education-volume-6-taylor-francis-ltd-9780415562133-essays-for-r-s-peters-david-cooper</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415562133.jpg?v=1767770757</image:loc>
      <image:title>Education, Values and Mind (International Library of the Philosophy of Education Volume 6)</image:title>
      <image:caption>Book cover of: Education, Values and Mind (International Library of the Philosophy of Education Volume 6). By: David Cooper</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-values-and-ethics-in-international-heritage-taylor-francis-inc-9780815399568-learning-to-respect-jeanette-atkinson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815399568.jpg?v=1767770757</image:loc>
      <image:title>Education, Values and Ethics in International Heritage</image:title>
      <image:caption>Book cover of: Education, Values and Ethics in International Heritage. By: Jeanette Atkinson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-society-and-human-nature-rle-edu-k-taylor-francis-ltd-9780415698221-an-introduction-to-the-philosophy-of-education-anthony-o-hear</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415698221.jpg?v=1767770761</image:loc>
      <image:title>Education, Society and Human Nature (RLE Edu K)</image:title>
      <image:caption>Book cover of: Education, Society and Human Nature (RLE Edu K). By: Anthony O&apos;Hear</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-theorie-vom-typischen-in-der-literatur-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631741795-bernhard-k-ppers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631741795.jpg?v=1767770760</image:loc>
      <image:title>Die Theorie vom Typischen in der Literatur</image:title>
      <image:caption>Book cover of: Die Theorie vom Typischen in der Literatur. By: Bernhard Küppers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-temperaturabhangigkeit-der-myomerenzahl-beim-hering-clupea-harengus-l-springer-berlin-heidelberg-9783662014752</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783662014752.jpg?v=1767770759</image:loc>
      <image:title>Die Temperaturabhangigkeit der Myomerenzahl beim Hering &lt;Clupea harengus L.&gt;</image:title>
      <image:caption>Book cover of: Die Temperaturabhangigkeit der Myomerenzahl beim Hering &lt;Clupea harengus L.&gt;</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-technik-und-beratungs-bank-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820479300-eine-analyse-organisatorischer-moeglichkeiten-zur-effizienzverbesserung-des-absatzes-von-universalbankleistungen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820479300.jpg?v=1767770760</image:loc>
      <image:title>Die Technik- und Beratungs-Bank</image:title>
      <image:caption>Book cover of: Die Technik- und Beratungs-Bank</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-theatertopographie-des-londoner-east-end-im-19-jahrhundert-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820491494</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820491494.jpg?v=1767770759</image:loc>
      <image:title>Die Theatertopographie des Londoner East End im 19. Jahrhundert</image:title>
      <image:caption>Book cover of: Die Theatertopographie des Londoner East End im 19. Jahrhundert</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-testierfaehigkeit-im-internationalen-privatrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631300718</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631300718.jpg?v=1767770760</image:loc>
      <image:title>Die Testierfaehigkeit im Internationalen Privatrecht</image:title>
      <image:caption>Book cover of: Die Testierfaehigkeit im Internationalen Privatrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-teilklage-im-deutschen-und-tuerkischen-zivilprozessrecht-peter-lang-ag-9783631531372</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631531372.jpg?v=1767770761</image:loc>
      <image:title>Die Teilklage Im Deutschen Und Tuerkischen Zivilprozessrecht</image:title>
      <image:caption>Book cover of: Die Teilklage Im Deutschen Und Tuerkischen Zivilprozessrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-technikwahl-bei-linearer-einzelproduktion-oder-die-dritte-krise-der-profitrate-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820496451</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820496451.jpg?v=1767770757</image:loc>
      <image:title>Die Technikwahl bei linearer Einzelproduktion oder Die dritte Krise der Profitrate</image:title>
      <image:caption>Book cover of: Die Technikwahl bei linearer Einzelproduktion oder Die dritte Krise der Profitrate</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-training-and-the-future-of-work-i-taylor-francis-ltd-9780415202084-social-political-and-economic-contexts-of-policy-development-john-ahier</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415202084.jpg?v=1767770759</image:loc>
      <image:title>Education, Training and the Future of Work I</image:title>
      <image:caption>Book cover of: Education, Training and the Future of Work I. By: John Ahier</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-self-consciousness-and-social-action-taylor-francis-ltd-9780367371401-bildung-as-a-neo-hegelian-concept-krassimir-stojanov</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367371401.jpg?v=1767770760</image:loc>
      <image:title>Education, Self-consciousness and Social Action</image:title>
      <image:caption>Book cover of: Education, Self-consciousness and Social Action. By: Krassimir Stojanov</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-social-status-and-health-taylor-francis-inc-9780202307077-catherine-ross</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780202307077.jpg?v=1767770758</image:loc>
      <image:title>Education, Social Status, and Health</image:title>
      <image:caption>Book cover of: Education, Social Status, and Health. By: Catherine Ross</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-society-and-human-nature-rle-edu-k-taylor-francis-ltd-9781138007581-an-introduction-to-the-philosophy-of-education-anthony-o-hear</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138007581.jpg?v=1767770760</image:loc>
      <image:title>Education, Society and Human Nature (RLE Edu K)</image:title>
      <image:caption>Book cover of: Education, Society and Human Nature (RLE Edu K). By: Anthony O&apos;Hear</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-security-and-intelligence-studies-taylor-francis-ltd-9780367251727-liam-gearon</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367251727.jpg?v=1767770760</image:loc>
      <image:title>Education, Security and Intelligence Studies</image:title>
      <image:caption>Book cover of: Education, Security and Intelligence Studies. By: Liam Gearon</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-taten-des-petrus-vandenhoeck-ruprecht-gmbh-co-kg-9783525534632-bernhard-lang</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783525534632.jpg?v=1767770761</image:loc>
      <image:title>Die Taten des Petrus</image:title>
      <image:caption>Book cover of: Die Taten des Petrus. By: Bernhard Lang</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-social-justice-and-inter-agency-working-taylor-francis-ltd-9780415249225-joined-up-or-fractured-policy-sheila-riddell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415249225.jpg?v=1767770761</image:loc>
      <image:title>Education, Social Justice and Inter-Agency Working</image:title>
      <image:caption>Book cover of: Education, Social Justice and Inter-Agency Working. By: Sheila Riddell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tatsachenerhebung-durch-den-sachverstaendigen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631500606</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631500606.jpg?v=1767770759</image:loc>
      <image:title>Die Tatsachenerhebung durch den Sachverstaendigen</image:title>
      <image:caption>Book cover of: Die Tatsachenerhebung durch den Sachverstaendigen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-self-consciousness-and-social-action-taylor-francis-ltd-9781138063129-bildung-as-a-neo-hegelian-concept-krassimir-stojanov</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138063129.jpg?v=1767770761</image:loc>
      <image:title>Education, Self-consciousness and Social Action</image:title>
      <image:caption>Book cover of: Education, Self-consciousness and Social Action. By: Krassimir Stojanov</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-security-and-intelligence-studies-taylor-francis-ltd-9781138088276-liam-gearon</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138088276.jpg?v=1767770759</image:loc>
      <image:title>Education, Security and Intelligence Studies</image:title>
      <image:caption>Book cover of: Education, Security and Intelligence Studies. By: Liam Gearon</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-research-and-practice-in-lesbian-gay-bisexual-and-transgendered-psychology-sage-publications-inc-9780803953826-a-resource-manual</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780803953826.jpg?v=1767770761</image:loc>
      <image:title>Education, Research, and Practice in Lesbian, Gay, Bisexual, and Transgendered Psychology</image:title>
      <image:caption>Book cover of: Education, Research, and Practice in Lesbian, Gay, Bisexual, and Transgendered Psychology</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-systematik-der-einnahme-ueberschussrechnung-gemae-4-abs-3-estg-peter-lang-ag-9783631516621-oliver-fein</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631516621.jpg?v=1767770763</image:loc>
      <image:title>Die Systematik Der Einnahme-Ueberschussrechnung Gemaeß § 4 Abs. 3 Estg</image:title>
      <image:caption>Book cover of: Die Systematik Der Einnahme-Ueberschussrechnung Gemaeß § 4 Abs. 3 Estg. By: Oliver Fein</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-social-background-and-cognitive-ability-taylor-francis-ltd-9780415842464-the-decline-of-the-social-gary-n-marks</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415842464.jpg?v=1767770760</image:loc>
      <image:title>Education, Social Background and Cognitive Ability</image:title>
      <image:caption>Book cover of: Education, Social Background and Cognitive Ability. By: Gary N. Marks</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-social-background-and-cognitive-ability-taylor-francis-ltd-9781138923225-the-decline-of-the-social-gary-n-marks</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138923225.jpg?v=1767770762</image:loc>
      <image:title>Education, Social Background and Cognitive Ability</image:title>
      <image:caption>Book cover of: Education, Social Background and Cognitive Ability. By: Gary N. Marks</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-synthese-von-todeskonzept-und-eigener-lebenszeitperspektive-beim-adoleszenten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631494578</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631494578.jpg?v=1767770764</image:loc>
      <image:title>Die Synthese von Todeskonzept und eigener Lebenszeitperspektive beim Adoleszenten</image:title>
      <image:caption>Book cover of: Die Synthese von Todeskonzept und eigener Lebenszeitperspektive beim Adoleszenten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-social-status-and-health-taylor-francis-inc-9780202307060-catherine-ross</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780202307060.jpg?v=1767770760</image:loc>
      <image:title>Education, Social Status, and Health</image:title>
      <image:caption>Book cover of: Education, Social Status, and Health. By: Catherine Ross</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-science-and-truth-taylor-francis-ltd-9780415997676-rasu-l-nizha-d-mihr</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415997676.jpg?v=1767770760</image:loc>
      <image:title>Education, Science and Truth</image:title>
      <image:caption>Book cover of: Education, Science and Truth. By: Rasūl Nizhādʹmihr</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tabaksteuer-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820409659-instrument-der-fiskalischen-einnahmeerzielung-und-der-gesellschaftlichen-verbrauchslenkung-geschichtliche-entwicklung-internationaler-vergleich-und-reformperspektiven</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820409659.jpg?v=1767770759</image:loc>
      <image:title>Die Tabaksteuer</image:title>
      <image:caption>Book cover of: Die Tabaksteuer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-religion-and-diversity-taylor-francis-ltd-9780415741590-developing-a-new-model-of-religious-education-l-philip-barnes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415741590.jpg?v=1767770762</image:loc>
      <image:title>Education, Religion and Diversity</image:title>
      <image:caption>Book cover of: Education, Religion and Diversity. By: L. Philip Barnes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-research-and-practice-in-lesbian-gay-bisexual-and-transgendered-psychology-sage-publications-inc-9780803953833-a-resource-manual</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780803953833.jpg?v=1767770762</image:loc>
      <image:title>Education, Research, and Practice in Lesbian, Gay, Bisexual, and Transgendered Psychology</image:title>
      <image:caption>Book cover of: Education, Research, and Practice in Lesbian, Gay, Bisexual, and Transgendered Psychology</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-and-the-state-taylor-francis-ltd-9780415237642-twenty-five-years-of-politics-policy-and-practice</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415237642.jpg?v=1767770759</image:loc>
      <image:title>Education, Reform and the State</image:title>
      <image:caption>Book cover of: Education, Reform and the State</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-tarifvertragliche-partizipation-an-unternehmensentscheidungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631442982-eine-rechtsvergleichende-untersuchung-am-beispiel-der-tarifvertragspraxis-in-italien</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631442982.jpg?v=1767770763</image:loc>
      <image:title>Die tarifvertragliche Partizipation an Unternehmensentscheidungen</image:title>
      <image:caption>Book cover of: Die tarifvertragliche Partizipation an Unternehmensentscheidungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-syntax-der-pis-ma-russkogo-putesestvennika-von-n-m-karamzin-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876907444</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876907444.jpg?v=1767770762</image:loc>
      <image:title>Die Syntax der &quot;Pis&apos;ma russkogo putesestvennika&quot; von N. M. Karamzin</image:title>
      <image:caption>Book cover of: Die Syntax der &quot;Pis&apos;ma russkogo putesestvennika&quot; von N. M. Karamzin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-suedjemenitischen-juden-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631347751-versuch-einer-rekonstruktion-ihrer-traditionellen-kultur-vor-dem-exodus</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631347751.jpg?v=1767770769</image:loc>
      <image:title>Die suedjemenitischen Juden</image:title>
      <image:caption>Book cover of: Die suedjemenitischen Juden</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-racism-and-reform-rle-edu-j-taylor-francis-ltd-9780415751124-barry-troyna</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415751124.jpg?v=1767770761</image:loc>
      <image:title>Education, Racism and Reform (RLE Edu J)</image:title>
      <image:caption>Book cover of: Education, Racism and Reform (RLE Edu J). By: Barry Troyna</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-suedaromunische-mundart-von-turia-pindos-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783932331596-syntax-lexik-ethnolinguistik-texte-m-bara</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783932331596.jpg?v=1767770763</image:loc>
      <image:title>Die suedaromunische Mundart von Turia (Pindos)</image:title>
      <image:caption>Book cover of: Die suedaromunische Mundart von Turia (Pindos). By: M Bara</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-religion-and-diversity-taylor-francis-ltd-9780415741583-developing-a-new-model-of-religious-education-l-philip-barnes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415741583.jpg?v=1767770761</image:loc>
      <image:title>Education, Religion and Diversity</image:title>
      <image:caption>Book cover of: Education, Religion and Diversity. By: L. Philip Barnes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-suche-nach-einer-neuen-nationalen-und-europaeischen-identitaet-bei-deutschen-tschechen-und-polen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631480021-aktuelle-probleme-der-europaeischen-erziehung-in-mitteleuropa</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631480021.jpg?v=1767770763</image:loc>
      <image:title>Die Suche nach einer neuen nationalen und europaeischen Identitaet bei Deutschen, Tschechen und Polen</image:title>
      <image:caption>Book cover of: Die Suche nach einer neuen nationalen und europaeischen Identitaet bei Deutschen, Tschechen und Polen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-and-the-state-taylor-francis-ltd-9781138166202-twenty-five-years-of-politics-policy-and-practice-john-furlong</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138166202.jpg?v=1767770762</image:loc>
      <image:title>Education, Reform and the State</image:title>
      <image:caption>Book cover of: Education, Reform and the State. By: John Furlong</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-training-and-the-future-of-work-ii-taylor-francis-ltd-9780415202114-developments-in-vocational-education-and-training-mike-flude</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415202114.jpg?v=1767770761</image:loc>
      <image:title>Education, Training and the Future of Work II</image:title>
      <image:caption>Book cover of: Education, Training and the Future of Work II. By: Mike Flude</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-professionalization-and-social-representations-taylor-francis-ltd-9780415885065-on-the-transformation-of-social-knowledge-mohamed-chaib</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415885065.jpg?v=1767770760</image:loc>
      <image:title>Education, Professionalization and Social Representations</image:title>
      <image:caption>Book cover of: Education, Professionalization and Social Representations. By: Mohamed Chaib</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-religion-and-society-taylor-francis-ltd-9780415649179-essays-in-honour-of-john-m-hull</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415649179.jpg?v=1767770761</image:loc>
      <image:title>Education, Religion and Society</image:title>
      <image:caption>Book cover of: Education, Religion and Society</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-professionalism-and-the-quest-for-accountability-taylor-francis-ltd-9780415855242-hitting-the-target-but-missing-the-point-jane-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415855242.jpg?v=1767770762</image:loc>
      <image:title>Education, Professionalism, and the Quest for Accountability</image:title>
      <image:caption>Book cover of: Education, Professionalism, and the Quest for Accountability. By: Jane Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-professionalization-and-social-representations-taylor-francis-ltd-9780415847315-on-the-transformation-of-social-knowledge-mohamed-chaib</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415847315.jpg?v=1767770763</image:loc>
      <image:title>Education, Professionalization and Social Representations</image:title>
      <image:caption>Book cover of: Education, Professionalization and Social Representations. By: Mohamed Chaib</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-suspendierung-von-hauptpflichten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820468526-unter-besonderer-beruecksichtigung-des-arbeitskampfrechts-eine-strukturale-analyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820468526.jpg?v=1767770763</image:loc>
      <image:title>Die Suspendierung von Hauptpflichten</image:title>
      <image:caption>Book cover of: Die Suspendierung von Hauptpflichten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-science-and-truth-taylor-francis-ltd-9780415647410-rasoul-nejadmehr</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415647410.jpg?v=1767770763</image:loc>
      <image:title>Education, Science and Truth</image:title>
      <image:caption>Book cover of: Education, Science and Truth. By: Rasoul Nejadmehr</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-submikroskopische-anatomie-und-pathologie-der-lunge-the-submicroscopic-anatomy-and-pathology-of-the-lung-springer-berlin-heidelberg-9783642490170-heribert-schulz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783642490170.jpg?v=1767770761</image:loc>
      <image:title>Die Submikroskopische Anatomie und Pathologie der Lunge / The Submicroscopic Anatomy and Pathology of the Lung</image:title>
      <image:caption>Book cover of: Die Submikroskopische Anatomie und Pathologie der Lunge / The Submicroscopic Anatomy and Pathology of the Lung. By: Heribert Schulz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-taggeldversicherung-im-rahmen-des-neuen-arbeitsvertragsrechts-peter-lang-international-academic-publishers-9783261029164-untersuchungen-zu-art-324a-abs-4-or</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261029164.jpg?v=1767770761</image:loc>
      <image:title>Die Taggeldversicherung im Rahmen des neuen Arbeitsvertragsrechts</image:title>
      <image:caption>Book cover of: Die Taggeldversicherung im Rahmen des neuen Arbeitsvertragsrechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-szenische-poetik-bozena-nemcovas-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876908151-theatralische-medialitaet-in-ihren-briefen-reiseskizzen-und-erzaehlwerken</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876908151.jpg?v=1767770764</image:loc>
      <image:title>Die szenische Poetik Bozena Nemcovas</image:title>
      <image:caption>Book cover of: Die szenische Poetik Bozena Nemcovas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-poverty-and-global-goals-for-gender-equality-taylor-francis-ltd-9780415823449-how-people-make-policy-happen-elaine-unterhalter</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415823449.jpg?v=1767770763</image:loc>
      <image:title>Education, Poverty and Global Goals for Gender Equality</image:title>
      <image:caption>Book cover of: Education, Poverty and Global Goals for Gender Equality. By: Elaine Unterhalter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-studieneingangsphase-in-der-lehrerausbildung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820476545-eine-empirische-untersuchung-zum-modell-der-faecherintegrativen-eingangsphase-im-studium-fuer-das-lehramt-an-grund-und-hauptschulen-an</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820476545.jpg?v=1767770761</image:loc>
      <image:title>Die Studieneingangsphase in der Lehrerausbildung</image:title>
      <image:caption>Book cover of: Die Studieneingangsphase in der Lehrerausbildung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-power-and-personal-biography-taylor-francis-ltd-9780415911801-dialogues-with-critical-educators-carlos-a-torres</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415911801.jpg?v=1767770762</image:loc>
      <image:title>Education, Power, and Personal Biography</image:title>
      <image:caption>Book cover of: Education, Power, and Personal Biography. By: Carlos A Torres</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-racism-and-reform-rle-edu-j-taylor-francis-ltd-9780415695138-barry-troyna</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415695138.jpg?v=1767770760</image:loc>
      <image:title>Education, Racism and Reform (RLE Edu J)</image:title>
      <image:caption>Book cover of: Education, Racism and Reform (RLE Edu J). By: Barry Troyna</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-poverty-and-gender-taylor-francis-inc-9780815373346-schooling-muslim-girls-in-india-latika-gupta</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815373346.jpg?v=1767770763</image:loc>
      <image:title>Education, Poverty and Gender</image:title>
      <image:caption>Book cover of: Education, Poverty and Gender. By: Latika Gupta</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-suche-nach-dem-himmel-im-denken-koreas-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820412406-eine-religionswissenschaftliche-und-philosophische-untersuchung-zur-hermeneutik-des-menschen-zwischen-himmel-und-erde</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820412406.jpg?v=1767770760</image:loc>
      <image:title>Die Suche nach dem Himmel im Denken Koreas</image:title>
      <image:caption>Book cover of: Die Suche nach dem Himmel im Denken Koreas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-religion-and-society-taylor-francis-ltd-9780415365628-essays-in-honour-of-john-m-hull</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415365628.jpg?v=1767770763</image:loc>
      <image:title>Education, Religion and Society</image:title>
      <image:caption>Book cover of: Education, Religion and Society</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-syntaktische-darstellung-von-koerperteilen-im-englischen-peter-lang-international-academic-publishers-9783261010476-studien-zu-einem-grenzgebiet-von-syntax-und-semantik</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261010476.jpg?v=1767770763</image:loc>
      <image:title>Die syntaktische Darstellung von Koerperteilen im Englischen</image:title>
      <image:caption>Book cover of: Die syntaktische Darstellung von Koerperteilen im Englischen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stumme-beziehungssprache-der-geschlechter-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631329030-eine-mikroanalyse-des-nonverbalen-interaktionsverhaltens-gegen-und-gleichgeschlechtlicher-dyaden</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631329030.jpg?v=1767770764</image:loc>
      <image:title>Die stumme Beziehungssprache der Geschlechter</image:title>
      <image:caption>Book cover of: Die stumme Beziehungssprache der Geschlechter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strukturforschung-in-der-klassischen-archaeologie-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906756318</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906756318.jpg?v=1767770764</image:loc>
      <image:title>Die Strukturforschung in der Klassischen Archaeologie</image:title>
      <image:caption>Book cover of: Die Strukturforschung in der Klassischen Archaeologie</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-symbolik-in-der-spaeteren-lyrik-brechts-peter-lang-international-academic-publishers-9783261025197</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261025197.jpg?v=1767770763</image:loc>
      <image:title>Die Symbolik in der spaeteren Lyrik Brechts</image:title>
      <image:caption>Book cover of: Die Symbolik in der spaeteren Lyrik Brechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-poverty-and-global-goals-for-gender-equality-taylor-francis-ltd-9780367203795-how-people-make-policy-happen-elaine-unterhalter</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367203795.jpg?v=1767770764</image:loc>
      <image:title>Education, Poverty and Global Goals for Gender Equality</image:title>
      <image:caption>Book cover of: Education, Poverty and Global Goals for Gender Equality. By: Elaine Unterhalter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-professionalism-and-the-quest-for-accountability-taylor-francis-ltd-9780415879255-hitting-the-target-but-missing-the-point-jane-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415879255.jpg?v=1767770762</image:loc>
      <image:title>Education, Professionalism, and the Quest for Accountability</image:title>
      <image:caption>Book cover of: Education, Professionalism, and the Quest for Accountability. By: Jane Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-suche-nach-dem-neuen-menschen-in-der-deutschen-und-russischen-literatur-der-jahrhundertwende-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876907901-frank-wedekinds-mine-haha-und-michail-petrovic-arcybasevs-sanin-daniel-schumann</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876907901.jpg?v=1767770766</image:loc>
      <image:title>Die Suche nach dem &quot;neuen&quot; Menschen in der deutschen und russischen Literatur der Jahrhundertwende</image:title>
      <image:caption>Book cover of: Die Suche nach dem &quot;neuen&quot; Menschen in der deutschen und russischen Literatur der Jahrhundertwende. By: Daniel Schumann</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-suende-im-alten-testament-peter-lang-ag-9783631446577</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631446577.jpg?v=1767770761</image:loc>
      <image:title>Die Suende Im Alten Testament</image:title>
      <image:caption>Book cover of: Die Suende Im Alten Testament</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strukturen-des-internationalen-handels-mit-investitionsguetern-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820469219-eine-empirische-untersuchung-unter-beruecksichtigung-der-qualitaet-der-daten</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820469219.jpg?v=1767770764</image:loc>
      <image:title>Die Strukturen des internationalen Handels mit Investitionsguetern</image:title>
      <image:caption>Book cover of: Die Strukturen des internationalen Handels mit Investitionsguetern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-syrische-handschrift-berlin-sachau-220-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820454208</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820454208.jpg?v=1767770761</image:loc>
      <image:title>Die syrische Handschrift Berlin Sachau 220</image:title>
      <image:caption>Book cover of: Die syrische Handschrift Berlin Sachau 220</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-power-and-personal-biography-taylor-francis-ltd-9780415911795-dialogues-with-critical-educators-carlos-a-torres</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415911795.jpg?v=1767770762</image:loc>
      <image:title>Education, Power, and Personal Biography</image:title>
      <image:caption>Book cover of: Education, Power, and Personal Biography. By: Carlos A Torres</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strukturpolitik-der-europaeischen-union-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631320464-eine-untersuchung-ihrer-konsistenz-im-hinblick-auf-die-verwirklichung-einer-wirtschafts-und-waehrungsunion</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631320464.jpg?v=1767770763</image:loc>
      <image:title>Die Strukturpolitik der Europaeischen Union</image:title>
      <image:caption>Book cover of: Die Strukturpolitik der Europaeischen Union</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-politics-and-religion-taylor-francis-ltd-9780415565486-reconciling-the-civil-and-the-sacred-in-education-james-arthur</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415565486.jpg?v=1767770764</image:loc>
      <image:title>Education, Politics and Religion</image:title>
      <image:caption>Book cover of: Education, Politics and Religion. By: James Arthur</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-poverty-and-gender-taylor-francis-ltd-9781138900844-schooling-muslim-girls-in-india-latika-gupta</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138900844.jpg?v=1767770764</image:loc>
      <image:title>Education, Poverty and Gender</image:title>
      <image:caption>Book cover of: Education, Poverty and Gender. By: Latika Gupta</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-struktur-des-zyklus-four-quartets-von-t-s-eliot-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820458107-eine-analyse-der-dichterischen-konstruktion-auf-textgenetischer-basis</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820458107.jpg?v=1767770764</image:loc>
      <image:title>Die Struktur des Zyklus Four Quartets von T.S. Eliot</image:title>
      <image:caption>Book cover of: Die Struktur des Zyklus Four Quartets von T.S. Eliot</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-struktur-der-tschechischen-lyrik-zu-beginn-des-20-jahrhunderts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876904177-untersuchungen-zum-lyrischen-fruehwerk-von-k-toman-f-sramek-und-f-gellner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876904177.jpg?v=1767770766</image:loc>
      <image:title>Die Struktur der tschechischen Lyrik zu Beginn des 20. Jahrhunderts</image:title>
      <image:caption>Book cover of: Die Struktur der tschechischen Lyrik zu Beginn des 20. Jahrhunderts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-struktur-des-zusammengesetzten-nominalpraedikats-im-altbulgarischen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876901183</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876901183.jpg?v=1767770763</image:loc>
      <image:title>Die Struktur des zusammengesetzten Nominalpraedikats im Altbulgarischen</image:title>
      <image:caption>Book cover of: Die Struktur des zusammengesetzten Nominalpraedikats im Altbulgarischen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-struktur-der-internationalen-liquiditaetskrise-seit-dem-ersten-oelpreisschub-l973-l974-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820489415-ursachen-schuldner-und-glaeubigerstruktur-loesungsansaetze</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820489415.jpg?v=1767770763</image:loc>
      <image:title>Die Struktur der internationalen Liquiditaetskrise seit dem ersten Oelpreisschub l973/l974</image:title>
      <image:caption>Book cover of: Die Struktur der internationalen Liquiditaetskrise seit dem ersten Oelpreisschub l973/l974</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-philosophy-and-well-being-taylor-francis-ltd-9781138290884-new-perspectives-on-the-work-of-john-white-judith-suissa</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138290884.jpg?v=1767770764</image:loc>
      <image:title>Education, Philosophy and Well-being</image:title>
      <image:caption>Book cover of: Education, Philosophy and Well-being. By: Judith Suissa</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stunde-omega-um-den-essigkrug-peter-lang-ltd-international-academic-publishers-9783039102723-zwei-dramatische-werke-aus-dem-nachlass-alfred-gongs-barbel-such</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783039102723.jpg?v=1767770766</image:loc>
      <image:title>Die Stunde Omega / Um Den Essigkrug</image:title>
      <image:caption>Book cover of: Die Stunde Omega / Um Den Essigkrug. By: Barbel Such</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-streitwertbemessung-bei-nachtraeglicher-rechtsmittelbeschraenkung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820459197</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820459197.jpg?v=1767770766</image:loc>
      <image:title>Die Streitwertbemessung bei nachtraeglicher Rechtsmittelbeschraenkung</image:title>
      <image:caption>Book cover of: Die Streitwertbemessung bei nachtraeglicher Rechtsmittelbeschraenkung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-politics-and-religion-taylor-francis-ltd-9780415565493-reconciling-the-civil-and-the-sacred-in-education-james-arthur</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415565493.jpg?v=1767770766</image:loc>
      <image:title>Education, Politics and Religion</image:title>
      <image:caption>Book cover of: Education, Politics and Religion. By: James Arthur</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-philosophy-and-the-ethical-environment-taylor-francis-ltd-9780415356619-graham-haydon</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415356619.jpg?v=1767770765</image:loc>
      <image:title>Education, Philosophy and the Ethical Environment</image:title>
      <image:caption>Book cover of: Education, Philosophy and the Ethical Environment. By: Graham Haydon</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-learning-and-the-transformation-of-development-taylor-francis-ltd-9781138952553-matt-baillie-smith</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138952553.jpg?v=1767770766</image:loc>
      <image:title>Education, Learning and the Transformation of Development</image:title>
      <image:caption>Book cover of: Education, Learning and the Transformation of Development. By: Matt Baillie Smith</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-modern-development-and-indigenous-knowledge-taylor-francis-ltd-9781138993341-an-analysis-of-academic-knowledge-production-seana-mcgovern</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138993341.jpg?v=1767770762</image:loc>
      <image:title>Education, Modern Development, and Indigenous Knowledge</image:title>
      <image:caption>Book cover of: Education, Modern Development, and Indigenous Knowledge. By: Seana McGovern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-philosophy-and-politics-taylor-francis-ltd-9780415686068-the-selected-works-of-michael-a-peters-peters-michael</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415686068.jpg?v=1767770763</image:loc>
      <image:title>Education, Philosophy and Politics</image:title>
      <image:caption>Book cover of: Education, Philosophy and Politics. By: Peters, Michael</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-philosophy-and-the-ethical-environment-taylor-francis-ltd-9780415356626-graham-haydon</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415356626.jpg?v=1767770763</image:loc>
      <image:title>Education, Philosophy and the Ethical Environment</image:title>
      <image:caption>Book cover of: Education, Philosophy and the Ethical Environment. By: Graham Haydon</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-markets-and-the-public-good-taylor-francis-ltd-9780415369947-the-selected-works-of-david-f-labaree-david-labaree</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415369947.jpg?v=1767770765</image:loc>
      <image:title>Education, Markets, and the Public Good</image:title>
      <image:caption>Book cover of: Education, Markets, and the Public Good. By: David Labaree</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-philosophy-and-well-being-taylor-francis-ltd-9781138021341-new-perspectives-on-the-work-of-john-white-roger-marples</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138021341.jpg?v=1767770764</image:loc>
      <image:title>Education, Philosophy and Well-being</image:title>
      <image:caption>Book cover of: Education, Philosophy and Well-being. By: Roger Marples</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-philosophy-and-politics-taylor-francis-ltd-9780415686051-the-selected-works-of-michael-a-peters-peters-michael</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415686051.jpg?v=1767770765</image:loc>
      <image:title>Education, Philosophy and Politics</image:title>
      <image:caption>Book cover of: Education, Philosophy and Politics. By: Peters, Michael</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-modern-development-and-indigenous-knowledge-taylor-francis-inc-9780815328407-an-analysis-of-academic-knowledge-production-seana-mcgovern</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815328407.jpg?v=1767770764</image:loc>
      <image:title>Education, Modern Development, and Indigenous Knowledge</image:title>
      <image:caption>Book cover of: Education, Modern Development, and Indigenous Knowledge. By: Seana McGovern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strategische-planung-als-komponente-eines-controllingsystems-im-krankenhaus-peter-lang-ag-9783631300879-eine-untersuchung-fuer-das-deutsche-krankenhauswesen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631300879.jpg?v=1767770765</image:loc>
      <image:title>Die Strategische Planung ALS Komponente Eines Controllingsystems Im Krankenhaus</image:title>
      <image:caption>Book cover of: Die Strategische Planung ALS Komponente Eines Controllingsystems Im Krankenhaus</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-nature-and-society-taylor-francis-ltd-9780415659482-stephen-gough</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415659482.jpg?v=1767770763</image:loc>
      <image:title>Education, Nature, and Society</image:title>
      <image:caption>Book cover of: Education, Nature, and Society. By: Stephen Gough</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-leadership-and-islam-taylor-francis-inc-9780815357001-theories-discourses-and-practices-from-an-islamic-perspective-saeeda-shah</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815357001.jpg?v=1767770765</image:loc>
      <image:title>Education, Leadership and Islam</image:title>
      <image:caption>Book cover of: Education, Leadership and Islam. By: Saeeda Shah</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-markets-and-the-public-good-taylor-francis-ltd-9780415369954-the-selected-works-of-david-f-labaree-david-labaree</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415369954.jpg?v=1767770765</image:loc>
      <image:title>Education, Markets, and the Public Good</image:title>
      <image:caption>Book cover of: Education, Markets, and the Public Good. By: David Labaree</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strahlkraft-der-stadt-schrifen-zu-film-und-geschichte-filmmuseumsynemapublications-synema-gesellschaft-fur-film-u-medien-9783901644665-siegfried-mattl</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783901644665.jpg?v=1767770764</image:loc>
      <image:title>Die Strahlkraft der Stadt  – Schrifen zu Film und Geschichte (Filmmuseumsynemapublications)</image:title>
      <image:caption>Book cover of: Die Strahlkraft der Stadt  – Schrifen zu Film und Geschichte (Filmmuseumsynemapublications). By: Siegfried Mattl</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strategische-positionierung-von-finanzdienstleistungsunternehmen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631458655</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631458655.jpg?v=1767770764</image:loc>
      <image:title>Die strategische Positionierung von Finanzdienstleistungsunternehmen</image:title>
      <image:caption>Book cover of: Die strategische Positionierung von Finanzdienstleistungsunternehmen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-indigenous-knowledges-and-development-in-the-global-south-taylor-francis-ltd-9780415629881-contesting-knowledges-for-a-sustainable-future-anders-breidlid</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415629881.jpg?v=1767770765</image:loc>
      <image:title>Education, Indigenous Knowledges, and Development in the Global South</image:title>
      <image:caption>Book cover of: Education, Indigenous Knowledges, and Development in the Global South. By: Anders Breidlid</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-leadership-and-islam-taylor-francis-ltd-9780415833578-theories-discourses-and-practices-from-an-islamic-perspective-saeeda-shah</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415833578.jpg?v=1767770763</image:loc>
      <image:title>Education, Leadership and Islam</image:title>
      <image:caption>Book cover of: Education, Leadership and Islam. By: Saeeda Shah</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-struktur-der-chemieindustrie-in-japan-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631339572-entwicklung-und-analyse-im-internationalen-kontext-und-im-vergleich-mit-deutschland-frank-rovekamp</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631339572.jpg?v=1767770767</image:loc>
      <image:title>Die Struktur der Chemieindustrie in Japan</image:title>
      <image:caption>Book cover of: Die Struktur der Chemieindustrie in Japan. By: Frank Rovekamp</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-mobilities-and-migration-taylor-francis-ltd-9781138655034-people-ideas-and-resources-madeleine-arnot</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138655034.jpg?v=1767770766</image:loc>
      <image:title>Education, Mobilities and Migration</image:title>
      <image:caption>Book cover of: Education, Mobilities and Migration. By: Madeleine Arnot</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-knowledge-and-truth-taylor-francis-ltd-9780415163170-beyond-the-postmodern-impasse-david-carr</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415163170.jpg?v=1767770764</image:loc>
      <image:title>Education, Knowledge and Truth</image:title>
      <image:caption>Book cover of: Education, Knowledge and Truth. By: David Carr</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafrechtliche-beurteilung-von-werken-der-kunst-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631490556</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631490556.jpg?v=1767770765</image:loc>
      <image:title>Die strafrechtliche Beurteilung von Werken der Kunst</image:title>
      <image:caption>Book cover of: Die strafrechtliche Beurteilung von Werken der Kunst</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-studierenden-an-wirtschaftsfachschulen-der-fachrichtung-handel-peter-lang-international-academic-publishers-9783261009616</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261009616.jpg?v=1767770766</image:loc>
      <image:title>Die Studierenden an Wirtschaftsfachschulen der Fachrichtung Handel</image:title>
      <image:caption>Book cover of: Die Studierenden an Wirtschaftsfachschulen der Fachrichtung Handel</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafschaerfende-verwertung-von-nach-154-154a-stpo-eingestellten-nebendelikten-und-ausgeschiedenen-tatteilen-bei-der-strafzumessung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820410976</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820410976.jpg?v=1767770766</image:loc>
      <image:title>Die strafschaerfende Verwertung von nach  154, 154a StPO eingestellten Nebendelikten und ausgeschiedenen Tatteilen bei der Strafzumessung</image:title>
      <image:caption>Book cover of: Die strafschaerfende Verwertung von nach  154, 154a StPO eingestellten Nebendelikten und ausgeschiedenen Tatteilen bei der Strafzumessung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-identity-and-women-religious-1800-1950-taylor-francis-ltd-9781138923546-convents-classrooms-and-colleges-dierdre-raftery</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138923546.jpg?v=1767770765</image:loc>
      <image:title>Education, Identity and Women Religious, 1800-1950</image:title>
      <image:caption>Book cover of: Education, Identity and Women Religious, 1800-1950. By: Dierdre Raftery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-learning-and-the-transformation-of-development-taylor-francis-ltd-9781138952546-amy-skinner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138952546.jpg?v=1767770767</image:loc>
      <image:title>Education, Learning and the Transformation of Development</image:title>
      <image:caption>Book cover of: Education, Learning and the Transformation of Development. By: Amy Skinner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-knowledge-and-truth-taylor-francis-ltd-9781138881068-beyond-the-postmodern-impasse-david-carr</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138881068.jpg?v=1767770765</image:loc>
      <image:title>Education, Knowledge and Truth</image:title>
      <image:caption>Book cover of: Education, Knowledge and Truth. By: David Carr</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafrechtliche-bewertung-des-aerztlichen-heileingriffs-nach-griechischem-und-deutschem-recht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820465129</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820465129.jpg?v=1767770765</image:loc>
      <image:title>Die strafrechtliche Bewertung des aerztlichen Heileingriffs nach griechischem und deutschem Recht</image:title>
      <image:caption>Book cover of: Die strafrechtliche Bewertung des aerztlichen Heileingriffs nach griechischem und deutschem Recht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-nihilism-and-survival-taylor-francis-inc-9780765807328</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780765807328.jpg?v=1767770766</image:loc>
      <image:title>Education, Nihilism, and Survival</image:title>
      <image:caption>Book cover of: Education, Nihilism, and Survival</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-globalization-and-the-nation-state-palgrave-macmillan-9780333683163</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780333683163.jpg?v=1767770768</image:loc>
      <image:title>Education, Globalization and the Nation State</image:title>
      <image:caption>Book cover of: Education, Globalization and the Nation State</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafbarkeit-wegen-verunreinigung-eines-gewaessers-324-stgb-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631417348-unter-besonderer-beruecksichtigung-der-behoerdlichen-genehmigung-als-rechtfertigungsgrund</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631417348.jpg?v=1767770768</image:loc>
      <image:title>Die Strafbarkeit wegen Verunreinigung eines Gewaessers ( 324 StGB)</image:title>
      <image:caption>Book cover of: Die Strafbarkeit wegen Verunreinigung eines Gewaessers ( 324 StGB)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafbarkeit-des-arbeitgebers-wegen-beitragsvorenthaltung-und-veruntreuung-von-arbeitsentgelt-266-a-stgb-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631447567</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631447567.jpg?v=1767770766</image:loc>
      <image:title>Die Strafbarkeit des Arbeitgebers wegen Beitragsvorenthaltung und Veruntreuung von Arbeitsentgelt ( 266 a StGB)</image:title>
      <image:caption>Book cover of: Die Strafbarkeit des Arbeitgebers wegen Beitragsvorenthaltung und Veruntreuung von Arbeitsentgelt ( 266 a StGB)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafbefreiende-fremdanzeige-gemae-371-abs-4-ao-peter-lang-ag-9783631546178-stefanie-zulauf</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631546178.jpg?v=1767770765</image:loc>
      <image:title>Die Strafbefreiende Fremdanzeige Gemaeß § 371 Abs. 4 Ao</image:title>
      <image:caption>Book cover of: Die Strafbefreiende Fremdanzeige Gemaeß § 371 Abs. 4 Ao. By: Stefanie Zulauf</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafbestimmungen-im-sozialversicherungsrecht-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906750927</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906750927.jpg?v=1767770766</image:loc>
      <image:title>Die Strafbestimmungen im Sozialversicherungsrecht</image:title>
      <image:caption>Book cover of: Die Strafbestimmungen im Sozialversicherungsrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafbarkeit-des-teilnehmers-beim-exze-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631473580</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631473580.jpg?v=1767770766</image:loc>
      <image:title>Die Strafbarkeit des Teilnehmers beim Exze</image:title>
      <image:caption>Book cover of: Die Strafbarkeit des Teilnehmers beim Exze</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafbarkeit-des-ladendiebstahls-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631467701-ein-beispiel-fuer-die-schwierigkeit-der-grenzbestimmung-des-strafrechts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631467701.jpg?v=1767770765</image:loc>
      <image:title>Die Strafbarkeit des Ladendiebstahls</image:title>
      <image:caption>Book cover of: Die Strafbarkeit des Ladendiebstahls</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-globalization-and-social-change-oxford-university-press-9780199272532</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780199272532.jpg?v=1767770765</image:loc>
      <image:title>Education, Globalization, and Social Change</image:title>
      <image:caption>Book cover of: Education, Globalization, and Social Change</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-justice-and-the-human-good-taylor-francis-ltd-9780415714808-fairness-and-equality-in-the-education-system-kirsten-meyer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415714808.jpg?v=1767770767</image:loc>
      <image:title>Education, Justice and the Human Good</image:title>
      <image:caption>Book cover of: Education, Justice and the Human Good. By: Kirsten Meyer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-gender-and-anxiety-taylor-francis-ltd-9780748401024</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780748401024.jpg?v=1767770767</image:loc>
      <image:title>Education, Gender And Anxiety</image:title>
      <image:caption>Book cover of: Education, Gender And Anxiety</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-globalisation-and-new-times-taylor-francis-ltd-9780415590785-21-years-of-the-journal-of-education-policy-stephen-j-ball</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415590785.jpg?v=1767770767</image:loc>
      <image:title>Education, Globalisation and New Times</image:title>
      <image:caption>Book cover of: Education, Globalisation and New Times. By: Stephen J. Ball</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-justice-and-democracy-the-university-of-chicago-press-9780226012766</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226012766.jpg?v=1767770767</image:loc>
      <image:title>Education, Justice, and Democracy</image:title>
      <image:caption>Book cover of: Education, Justice, and Democracy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-streikarbeit-in-der-arbeitskampfordnung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820498486-zur-rechtmaessigkeit-der-anordnung-bzw-der-verweigerung-von-streikarbeit-im-arbeits-und-beamtenrecht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820498486.jpg?v=1767770764</image:loc>
      <image:title>Die Streikarbeit in der Arbeitskampfordnung</image:title>
      <image:caption>Book cover of: Die Streikarbeit in der Arbeitskampfordnung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strategische-verteidigungsinitiative-sdi-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820411492-zur-politischen-diskussion-in-der-bundesrepublik-deutschland</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820411492.jpg?v=1767770766</image:loc>
      <image:title>Die Strategische Verteidigungsinitiative (SDI)</image:title>
      <image:caption>Book cover of: Die Strategische Verteidigungsinitiative (SDI)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-identity-and-women-religious-1800-1950-taylor-francis-inc-9780815358534-convents-classrooms-and-colleges-deirdre-raftery</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815358534.jpg?v=1767770767</image:loc>
      <image:title>Education, Identity and Women Religious, 1800-1950</image:title>
      <image:caption>Book cover of: Education, Identity and Women Religious, 1800-1950. By: Deirdre Raftery</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-experience-and-existence-taylor-francis-ltd-9780415825856-engaging-dewey-peirce-and-heidegger-john-quay</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415825856.jpg?v=1767770765</image:loc>
      <image:title>Education, Experience and Existence</image:title>
      <image:caption>Book cover of: Education, Experience and Existence. By: John Quay</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-globalisation-and-new-times-taylor-francis-ltd-9780415425988-21-years-of-the-journal-of-education-policy-stephen-ball</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415425988.jpg?v=1767770767</image:loc>
      <image:title>Education, Globalisation and New Times</image:title>
      <image:caption>Book cover of: Education, Globalisation and New Times. By: Stephen, Ball</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stillschweigende-rechtswahl-im-proze-im-system-der-subjektiven-anknuepfungen-im-deutschen-internationalen-privatrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631329580</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631329580.jpg?v=1767770767</image:loc>
      <image:title>Die stillschweigende Rechtswahl im Proze im System der subjektiven Anknuepfungen im deutschen Internationalen Privatrecht</image:title>
      <image:caption>Book cover of: Die stillschweigende Rechtswahl im Proze im System der subjektiven Anknuepfungen im deutschen Internationalen Privatrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafbarkeit-des-sexuellen-mi-brauchs-in-der-psychotherapie-gem-den-174-ff-stgb-peter-lang-ag-9783631349229-roger-spenner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631349229.jpg?v=1767770766</image:loc>
      <image:title>Die Strafbarkeit Des «Sexuellen Mißbrauchs» in Der Psychotherapie Gem. Den §§ 174 Ff Stgb</image:title>
      <image:caption>Book cover of: Die Strafbarkeit Des «Sexuellen Mißbrauchs» in Der Psychotherapie Gem. Den §§ 174 Ff Stgb. By: Roger Spenner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafbarkeit-der-offenbarung-hoechstpersoenlicher-daten-des-ungeborenen-menschen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631470862</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631470862.jpg?v=1767770766</image:loc>
      <image:title>Die Strafbarkeit der Offenbarung hoechstpersoenlicher Daten des ungeborenen Menschen</image:title>
      <image:caption>Book cover of: Die Strafbarkeit der Offenbarung hoechstpersoenlicher Daten des ungeborenen Menschen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-industrialization-and-the-end-of-empire-in-singapore-taylor-francis-ltd-9781138679764-kevin-blackburn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138679764.jpg?v=1767770767</image:loc>
      <image:title>Education, Industrialization and the End of Empire in Singapore</image:title>
      <image:caption>Book cover of: Education, Industrialization and the End of Empire in Singapore. By: Kevin Blackburn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-ethics-and-experience-taylor-francis-inc-9780815396635-essays-in-honour-of-richard-pring-michael-hand</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815396635.jpg?v=1767770766</image:loc>
      <image:title>Education, Ethics and Experience</image:title>
      <image:caption>Book cover of: Education, Ethics and Experience. By: Michael Hand</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-indigenous-knowledges-and-development-in-the-global-south-taylor-francis-ltd-9780415895897-contesting-knowledges-for-a-sustainable-future-anders-breidlid</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415895897.jpg?v=1767770767</image:loc>
      <image:title>Education, Indigenous Knowledges, and Development in the Global South</image:title>
      <image:caption>Book cover of: Education, Indigenous Knowledges, and Development in the Global South. By: Anders Breidlid</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-gender-and-anxiety-taylor-francis-ltd-9780748401017</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780748401017.jpg?v=1767770768</image:loc>
      <image:title>Education, Gender And Anxiety</image:title>
      <image:caption>Book cover of: Education, Gender And Anxiety</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-experience-and-existence-taylor-francis-ltd-9781138941281-engaging-dewey-peirce-and-heidegger-john-quay</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138941281.jpg?v=1767770767</image:loc>
      <image:title>Education, Experience and Existence</image:title>
      <image:caption>Book cover of: Education, Experience and Existence. By: John Quay</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-straftaten-des-alten-menschen-peter-lang-international-academic-publishers-9783261000774-elisabeth-fopp</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261000774.jpg?v=1767770771</image:loc>
      <image:title>Die Straftaten des alten Menschen</image:title>
      <image:caption>Book cover of: Die Straftaten des alten Menschen. By: Elisabeth Fopp</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stille-gesellschaft-im-internationalen-steuerrecht-aus-deutscher-sicht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631316955</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631316955.jpg?v=1767770768</image:loc>
      <image:title>Die stille Gesellschaft im internationalen Steuerrecht aus deutscher Sicht</image:title>
      <image:caption>Book cover of: Die stille Gesellschaft im internationalen Steuerrecht aus deutscher Sicht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-ethics-and-experience-taylor-francis-ltd-9781138860414-essays-in-honour-of-richard-pring</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138860414.jpg?v=1767770768</image:loc>
      <image:title>Education, Ethics and Experience</image:title>
      <image:caption>Book cover of: Education, Ethics and Experience</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-ethnicity-society-and-global-change-in-asia-taylor-francis-ltd-9780367141813-the-selected-works-of-gerard-a-postiglione-gerard-a-postiglione</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367141813.jpg?v=1767770768</image:loc>
      <image:title>Education, Ethnicity, Society and Global Change in Asia</image:title>
      <image:caption>Book cover of: Education, Ethnicity, Society and Global Change in Asia. By: Gerard A. Postiglione</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerunion-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820401523-probleme-der-harmonisierung-spezifischer-guetersteuern</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820401523.jpg?v=1767770766</image:loc>
      <image:title>Die Steuerunion</image:title>
      <image:caption>Book cover of: Die Steuerunion</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-ethics-and-existence-taylor-francis-ltd-9781138852891-camus-and-the-human-condition-peter-roberts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138852891.jpg?v=1767770768</image:loc>
      <image:title>Education, Ethics and Existence</image:title>
      <image:caption>Book cover of: Education, Ethics and Existence. By: Peter Roberts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafrechtliche-verantwortlichkeit-der-mitglieder-von-kollegialorganen-peter-lang-ag-9783631490006-dargestellt-am-beispiel-der-geschaeftsleitungsgremien-von-wirtschaftsunternehmen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631490006.jpg?v=1767770766</image:loc>
      <image:title>Die Strafrechtliche Verantwortlichkeit Der Mitglieder Von Kollegialorganen</image:title>
      <image:caption>Book cover of: Die Strafrechtliche Verantwortlichkeit Der Mitglieder Von Kollegialorganen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-epistemology-and-critical-realism-taylor-francis-ltd-9780415473491-david-scott</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415473491.jpg?v=1767770767</image:loc>
      <image:title>Education, Epistemology and Critical Realism</image:title>
      <image:caption>Book cover of: Education, Epistemology and Critical Realism. By: David Scott</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerstrafrechtliche-behandlung-des-einkommenslosen-ehegatten-bei-der-zusammenveranlagung-peter-lang-ag-9783631389256</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631389256.jpg?v=1767770767</image:loc>
      <image:title>Die Steuerstrafrechtliche Behandlung Des Einkommenslosen Ehegatten Bei Der Zusammenveranlagung</image:title>
      <image:caption>Book cover of: Die Steuerstrafrechtliche Behandlung Des Einkommenslosen Ehegatten Bei Der Zusammenveranlagung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-employment-and-migration-cambridge-university-press-9780521215862-israel-in-comparative-perspective</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521215862.jpg?v=1767770768</image:loc>
      <image:title>Education, Employment, and Migration</image:title>
      <image:caption>Book cover of: Education, Employment, and Migration</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stiftung-im-system-des-unterordnungs-konzerns-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631500699</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631500699.jpg?v=1767770769</image:loc>
      <image:title>Die Stiftung im System des Unterordnungs-Konzerns</image:title>
      <image:caption>Book cover of: Die Stiftung im System des Unterordnungs-Konzerns</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-education-education-taylor-francis-ltd-9780415335508-the-best-bits-of-ted-wragg-wragg-e-c</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415335508.jpg?v=1767770768</image:loc>
      <image:title>Education, Education, Education</image:title>
      <image:caption>Book cover of: Education, Education, Education. By: Wragg, E. C.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-strafbare-deliktsvorbereitung-unter-besonderer-beruecksichtigung-des-234a-abs-3-stgb-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631462324</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631462324.jpg?v=1767770768</image:loc>
      <image:title>Die strafbare Deliktsvorbereitung unter besonderer Beruecksichtigung des  234a Abs. 3 StGB</image:title>
      <image:caption>Book cover of: Die strafbare Deliktsvorbereitung unter besonderer Beruecksichtigung des  234a Abs. 3 StGB</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-ethics-and-existence-taylor-francis-ltd-9781138057548-camus-and-the-human-condition-peter-roberts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138057548.jpg?v=1767770769</image:loc>
      <image:title>Education, Ethics and Existence</image:title>
      <image:caption>Book cover of: Education, Ethics and Existence. By: Peter Roberts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-education-education-taylor-francis-ltd-9780415335515-the-best-bits-of-ted-wragg-wragg-e-c</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415335515.jpg?v=1767770767</image:loc>
      <image:title>Education, Education, Education</image:title>
      <image:caption>Book cover of: Education, Education, Education. By: Wragg, E. C.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerung-von-inflationserwartungen-durch-eine-gewinnmaximierende-notenbank-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820474510-diskussion-einer-alternativen-geldpolitischen-konzeption</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820474510.jpg?v=1767770766</image:loc>
      <image:title>Die Steuerung von Inflationserwartungen durch eine gewinnmaximierende Notenbank</image:title>
      <image:caption>Book cover of: Die Steuerung von Inflationserwartungen durch eine gewinnmaximierende Notenbank</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-gender-and-development-taylor-francis-ltd-9781138673045-a-capabilities-perspective-mari-anne-okkolin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138673045.jpg?v=1767770767</image:loc>
      <image:title>Education, Gender and Development</image:title>
      <image:caption>Book cover of: Education, Gender and Development. By: Mari-Anne Okkolin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stiftung-co-kg-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631485538</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631485538.jpg?v=1767770767</image:loc>
      <image:title>Die Stiftung &amp; Co.KG</image:title>
      <image:caption>Book cover of: Die Stiftung &amp; Co.KG</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerverfahrensrechtliche-bewaeltigung-der-verlustfeststellung-im-einkommensteuerrecht-peter-lang-ag-9783631520512-carsten-pohl</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631520512.jpg?v=1767770766</image:loc>
      <image:title>Die Steuerverfahrensrechtliche Bewaeltigung Der Verlustfeststellung Im Einkommensteuerrecht</image:title>
      <image:caption>Book cover of: Die Steuerverfahrensrechtliche Bewaeltigung Der Verlustfeststellung Im Einkommensteuerrecht. By: Carsten Pohl</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-democracy-and-public-knowledge-taylor-francis-ltd-9780367004897-elizabeth-a-kelly</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367004897.jpg?v=1767770766</image:loc>
      <image:title>Education, Democracy, And Public Knowledge</image:title>
      <image:caption>Book cover of: Education, Democracy, And Public Knowledge. By: Elizabeth A. Kelly</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-epistemology-and-critical-realism-taylor-francis-ltd-9780415617185-david-scott</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415617185.jpg?v=1767770768</image:loc>
      <image:title>Education, Epistemology and Critical Realism</image:title>
      <image:caption>Book cover of: Education, Epistemology and Critical Realism. By: David Scott</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-cultures-and-economics-taylor-francis-inc-9780815327837-dilemmas-for-development-angela-w-little</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815327837.jpg?v=1767770769</image:loc>
      <image:title>Education, Cultures, and Economics</image:title>
      <image:caption>Book cover of: Education, Cultures, and Economics. By: Angela W Little</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerlichen-herstellungskosten-peter-lang-ag-9783631550113-eine-mehrparametrische-steuerwirkungsanalyse-fuer-die-verschmelzung-von-kapitalgesellschaften-maren-l-schwarz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631550113.jpg?v=1767770767</image:loc>
      <image:title>Die Steuerlichen Herstellungskosten</image:title>
      <image:caption>Book cover of: Die Steuerlichen Herstellungskosten. By: Maren L. Schwarz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stille-gesellschaft-im-recht-der-publikumspersonengesellschaften-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631429129</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631429129.jpg?v=1767770767</image:loc>
      <image:title>Die stille Gesellschaft im Recht der Publikumspersonengesellschaften</image:title>
      <image:caption>Book cover of: Die stille Gesellschaft im Recht der Publikumspersonengesellschaften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-disordered-eating-and-obesity-discourse-taylor-francis-ltd-9780415418942-fat-fabrications-john-evans</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415418942.jpg?v=1767770769</image:loc>
      <image:title>Education, Disordered Eating and Obesity Discourse</image:title>
      <image:caption>Book cover of: Education, Disordered Eating and Obesity Discourse. By: John Evans</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-disordered-eating-and-obesity-discourse-taylor-francis-ltd-9780415418959-fat-fabrications-john-evans</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415418959.jpg?v=1767770769</image:loc>
      <image:title>Education, Disordered Eating and Obesity Discourse</image:title>
      <image:caption>Book cover of: Education, Disordered Eating and Obesity Discourse. By: John Evans</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-economic-change-and-society-in-england-1780-1870-cambridge-university-press-9780521557795</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521557795.jpg?v=1767770768</image:loc>
      <image:title>Education, Economic Change and Society in England 1780–1870</image:title>
      <image:caption>Book cover of: Education, Economic Change and Society in England 1780–1870</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerliche-behandlung-investiv-verwendeter-einkommensbestandteile-im-spannungsfeld-zwischen-systemwahrung-und-systemveraenderung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631356296-ulrich-niehus</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631356296.jpg?v=1767770767</image:loc>
      <image:title>Die steuerliche Behandlung investiv verwendeter Einkommensbestandteile im Spannungsfeld zwischen Systemwahrung und Systemveraenderung</image:title>
      <image:caption>Book cover of: Die steuerliche Behandlung investiv verwendeter Einkommensbestandteile im Spannungsfeld zwischen Systemwahrung und Systemveraenderung. By: Ulrich Niehus</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerung-des-unterrichtsablaufs-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820469981-eine-empirische-untersuchung-am-mathematikunterricht-des-4-schuljahres</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820469981.jpg?v=1767770770</image:loc>
      <image:title>Die Steuerung des Unterrichtsablaufs</image:title>
      <image:caption>Book cover of: Die Steuerung des Unterrichtsablaufs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-von-sanierungskrediten-im-insolvenzrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631464861</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631464861.jpg?v=1767770767</image:loc>
      <image:title>Die Stellung von Sanierungskrediten im Insolvenzrecht</image:title>
      <image:caption>Book cover of: Die Stellung von Sanierungskrediten im Insolvenzrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-employment-and-migration-cambridge-university-press-9780521291927-israel-in-comparative-perspective</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521291927.jpg?v=1767770767</image:loc>
      <image:title>Education, Employment, and Migration</image:title>
      <image:caption>Book cover of: Education, Employment, and Migration</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerliche-anerkennung-von-familienpersonengesellschaften-bei-fehlerhaftem-gesellschaftsvertrag-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631349595-zur-anwendung-der-lehre-von-der-fehlerhaften-gesellschaft-im-steuerrecht-christoph</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631349595.jpg?v=1767770769</image:loc>
      <image:title>Die steuerliche Anerkennung von Familienpersonengesellschaften bei fehlerhaftem Gesellschaftsvertrag</image:title>
      <image:caption>Book cover of: Die steuerliche Anerkennung von Familienpersonengesellschaften bei fehlerhaftem Gesellschaftsvertrag. By: Christoph Nawroth</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerhehlerei-374-ao-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631458792-eine-normanalyse-unter-beruecksichtigung-des-vergleichstatbestandes-259-stgb</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631458792.jpg?v=1767770767</image:loc>
      <image:title>Die Steuerhehlerei  374 AO</image:title>
      <image:caption>Book cover of: Die Steuerhehlerei  374 AO</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerliche-erfassung-realisierter-stiller-reserven-des-anlagevermoegens-in-den-ewg-staaten-belgien-bundesrepublik-deutschland-frankreich-grossbritannien-und-niederlande-peter-lang-international-academic-publishers-9783261011930-ein-rechtsvergleichend</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261011930.jpg?v=1767770767</image:loc>
      <image:title>Die steuerliche Erfassung realisierter stiller Reserven des Anlagevermoegens in den EWG-Staaten Belgien, Bundesrepublik Deutschland, Frankreich, Grossbritannien und Niederlande</image:title>
      <image:caption>Book cover of: Die steuerliche Erfassung realisierter stiller Reserven des Anlagevermoegens in den EWG-Staaten Belgien, Bundesrepublik Deutschland, Frankreich, Grossbritannien und Niederlande</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-class-language-and-ideology-rle-edu-l-taylor-francis-ltd-9780415752855-noelle-bisseret</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415752855.jpg?v=1767770768</image:loc>
      <image:title>Education, Class Language and Ideology (RLE Edu L)</image:title>
      <image:caption>Book cover of: Education, Class Language and Ideology (RLE Edu L). By: Noelle Bisseret</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-des-wettbewerbers-im-beihilfenaufsichtsverfahren-der-europaeischen-gemeinschaft-peter-lang-ag-9783631374863-eine-analyse-der-verfahrensrechte-und-der-gerichtlichen-rechtsschutzmoeglichkeiten-anne-wagner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631374863.jpg?v=1767770768</image:loc>
      <image:title>Die Stellung Des Wettbewerbers Im Beihilfenaufsichtsverfahren Der Europaeischen Gemeinschaft</image:title>
      <image:caption>Book cover of: Die Stellung Des Wettbewerbers Im Beihilfenaufsichtsverfahren Der Europaeischen Gemeinschaft. By: Anne Wagner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerliche-behandlung-von-einkuenften-aus-erfindungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820494075-ein-internationaler-vergleich</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820494075.jpg?v=1767770768</image:loc>
      <image:title>Die steuerliche Behandlung von Einkuenften aus Erfindungen</image:title>
      <image:caption>Book cover of: Die steuerliche Behandlung von Einkuenften aus Erfindungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-democracy-and-development-springer-9780792345527-an-international-perspective-raymond-ryba</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780792345527.jpg?v=1767770767</image:loc>
      <image:title>Education, Democracy and Development</image:title>
      <image:caption>Book cover of: Education, Democracy and Development. By: Raymond Ryba</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerpolitische-willensbildung-bei-der-koerperschaftsteuerreform-1977-peter-lang-gmbh-9783820472271</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820472271.jpg?v=1767770769</image:loc>
      <image:title>Die Steuerpolitische Willensbildung Bei Der Koerperschaftsteuerreform 1977</image:title>
      <image:caption>Book cover of: Die Steuerpolitische Willensbildung Bei Der Koerperschaftsteuerreform 1977</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerliche-behandlung-der-testamentsvollstreckerverguetung-peter-lang-ag-9783631337240-christian-kirnberger</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631337240.jpg?v=1767770768</image:loc>
      <image:title>Die Steuerliche Behandlung Der Testamentsvollstreckerverguetung</image:title>
      <image:caption>Book cover of: Die Steuerliche Behandlung Der Testamentsvollstreckerverguetung. By: Christian Kirnberger</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-dritter-im-europaeischen-wettbewerbsverfahren-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631426388-eine-vergleichende-untersuchung-mit-blick-auf-das-antidumping-und-egks-recht-sowie-ausgewaehlte-nationale-rechtsordnungen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631426388.jpg?v=1767770769</image:loc>
      <image:title>Die Stellung Dritter im europaeischen Wettbewerbsverfahren</image:title>
      <image:caption>Book cover of: Die Stellung Dritter im europaeischen Wettbewerbsverfahren</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-cultures-and-economics-taylor-francis-ltd-9781138968455-dilemmas-for-development-angela-w-little</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138968455.jpg?v=1767770768</image:loc>
      <image:title>Education, Cultures, and Economics</image:title>
      <image:caption>Book cover of: Education, Cultures, and Economics. By: Angela W. Little</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerrechtliche-selbstanzeige-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631432471-zur-kriminalpolitischen-zweckmaeigkeit-des-371-ao</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631432471.jpg?v=1767770771</image:loc>
      <image:title>Die steuerrechtliche Selbstanzeige</image:title>
      <image:caption>Book cover of: Die steuerrechtliche Selbstanzeige</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-des-antragsgegners-im-prozekostenhilfeverfahren-und-seine-daraus-folgenden-rechte-und-pflichten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631317457</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631317457.jpg?v=1767770771</image:loc>
      <image:title>Die Stellung des Antragsgegners im Prozekostenhilfeverfahren und seine daraus folgenden Rechte und Pflichten</image:title>
      <image:caption>Book cover of: Die Stellung des Antragsgegners im Prozekostenhilfeverfahren und seine daraus folgenden Rechte und Pflichten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-democracy-and-inequality-palgrave-macmillan-9781137489753-political-engagement-and-citizenship-education-in-europe-bryony-hoskins</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781137489753.jpg?v=1767770769</image:loc>
      <image:title>Education, Democracy and Inequality</image:title>
      <image:caption>Book cover of: Education, Democracy and Inequality. By: Bryony Hoskins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-class-language-and-ideology-rle-edu-l-taylor-francis-ltd-9780415504140-noelle-bisseret</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415504140.jpg?v=1767770768</image:loc>
      <image:title>Education, Class Language and Ideology (RLE Edu L)</image:title>
      <image:caption>Book cover of: Education, Class Language and Ideology (RLE Edu L). By: Noelle Bisseret</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-exclusion-and-citizenship-taylor-francis-ltd-9780415174978</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415174978.jpg?v=1767770766</image:loc>
      <image:title>Education, Exclusion and Citizenship</image:title>
      <image:caption>Book cover of: Education, Exclusion and Citizenship</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-with-character-taylor-francis-ltd-9780415277785</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415277785.jpg?v=1767770768</image:loc>
      <image:title>Education with Character</image:title>
      <image:caption>Book cover of: Education with Character</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-des-lehrerverbandes-niedersachsen-gewerkschaft-erziehung-und-wissenschaft-in-der-niedersaechsischen-schulpolitik-1946-1954-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820469738</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820469738.jpg?v=1767770767</image:loc>
      <image:title>Die Stellung des Lehrerverbandes Niedersachsen (Gewerkschaft Erziehung und Wissenschaft) in der niedersaechsischen Schulpolitik 1946-1954</image:title>
      <image:caption>Book cover of: Die Stellung des Lehrerverbandes Niedersachsen (Gewerkschaft Erziehung und Wissenschaft) in der niedersaechsischen Schulpolitik 1946-1954</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-childhood-and-anarchism-taylor-francis-ltd-9781138669888-talking-colin-ward-catherine-burke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138669888.jpg?v=1767770770</image:loc>
      <image:title>Education, Childhood and Anarchism</image:title>
      <image:caption>Book cover of: Education, Childhood and Anarchism. By: Catherine Burke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-autonomy-and-critical-thinking-taylor-francis-ltd-9780415322379</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415322379.jpg?v=1767770770</image:loc>
      <image:title>Education, Autonomy and Critical Thinking</image:title>
      <image:caption>Book cover of: Education, Autonomy and Critical Thinking</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerabgrenzung-im-handelsrechtlichen-jahresabschlu-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631444771-ein-beitrag-zu-der-systematischen-erfassung-bewertung-und-dem-ausweis-latenter-steuern-in-bilanz-erfolgsrechnung-und-anhang</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631444771.jpg?v=1767770768</image:loc>
      <image:title>Die Steuerabgrenzung im handelsrechtlichen Jahresabschlu</image:title>
      <image:caption>Book cover of: Die Steuerabgrenzung im handelsrechtlichen Jahresabschlu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-der-nahrungs-und-genussmittelindustrie-im-prozess-der-industrialisierung-peter-lang-international-academic-publishers-9783261010544</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261010544.jpg?v=1767770769</image:loc>
      <image:title>Die Stellung der Nahrungs- und Genussmittelindustrie im Prozess der Industrialisierung</image:title>
      <image:caption>Book cover of: Die Stellung der Nahrungs- und Genussmittelindustrie im Prozess der Industrialisierung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-autonomy-and-democratic-citizenship-taylor-francis-ltd-9780415153348-philosophy-in-a-changing-world-david-bridges</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415153348.jpg?v=1767770770</image:loc>
      <image:title>Education, Autonomy and Democratic Citizenship</image:title>
      <image:caption>Book cover of: Education, Autonomy and Democratic Citizenship. By: David Bridges</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-der-nationalen-minderheiten-in-den-verfassungen-der-baltischen-republiken-und-ihre-einfachgesetzliche-umsetzung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631311080-andreas-graudin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631311080.jpg?v=1767770770</image:loc>
      <image:title>Die Stellung der nationalen Minderheiten in den Verfassungen der baltischen Republiken und ihre einfachgesetzliche Umsetzung</image:title>
      <image:caption>Book cover of: Die Stellung der nationalen Minderheiten in den Verfassungen der baltischen Republiken und ihre einfachgesetzliche Umsetzung. By: Andreas Graudin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-nationaler-befreiungsbewegungen-im-voelkerrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820452419</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820452419.jpg?v=1767770772</image:loc>
      <image:title>Die Stellung nationaler Befreiungsbewegungen im Voelkerrecht</image:title>
      <image:caption>Book cover of: Die Stellung nationaler Befreiungsbewegungen im Voelkerrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-der-verteidigung-im-reformierten-strafproze-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631447239-eine-rechtshistorische-studie-anhand-der-schriften-von-c-j-a-mittermaier</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631447239.jpg?v=1767770771</image:loc>
      <image:title>Die Stellung der Verteidigung im reformierten Strafproze</image:title>
      <image:caption>Book cover of: Die Stellung der Verteidigung im reformierten Strafproze</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-des-hinterlegers-am-sammelbestand-von-wertrechten-nach-deutschem-und-franzoesischem-recht-peter-lang-ag-9783631323328</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631323328.jpg?v=1767770768</image:loc>
      <image:title>Die Stellung Des Hinterlegers Am Sammelbestand Von Wertrechten Nach Deutschem Und Franzoesischem Recht</image:title>
      <image:caption>Book cover of: Die Stellung Des Hinterlegers Am Sammelbestand Von Wertrechten Nach Deutschem Und Franzoesischem Recht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-statuten-der-banken-sparkassen-und-kreditgenossenschaften-in-hamburg-und-altona-von-1710-1889-peter-lang-international-academic-publishers-9783261024183</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261024183.jpg?v=1767770771</image:loc>
      <image:title>Die Statuten der Banken, Sparkassen und Kreditgenossenschaften in Hamburg und Altona von 1710-1889</image:title>
      <image:caption>Book cover of: Die Statuten der Banken, Sparkassen und Kreditgenossenschaften in Hamburg und Altona von 1710-1889</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-steuerung-auslaendischer-tochtergesellschaften-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820490206-instrumente-und-effizienz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820490206.jpg?v=1767770769</image:loc>
      <image:title>Die Steuerung auslaendischer Tochtergesellschaften</image:title>
      <image:caption>Book cover of: Die Steuerung auslaendischer Tochtergesellschaften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-cultural-myths-and-the-ecological-crisis-state-university-of-new-york-press-9780791412565-toward-deep-changes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-capitalism-and-the-global-crisis-taylor-francis-ltd-9781138817616-stephen-ball</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138817616.jpg?v=1767770770</image:loc>
      <image:title>Education, Capitalism and the Global Crisis</image:title>
      <image:caption>Book cover of: Education, Capitalism and the Global Crisis. By: Stephen Ball</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-childhood-and-anarchism-taylor-francis-ltd-9780415820608-talking-colin-ward-catherine-burke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415820608.jpg?v=1767770770</image:loc>
      <image:title>Education, Childhood and Anarchism</image:title>
      <image:caption>Book cover of: Education, Childhood and Anarchism. By: Catherine Burke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stadt-der-architekten-birkhauser-9783764370640-anatomie-einer-selbstdemontage-angelus-eisinger</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783764370640.jpg?v=1767770770</image:loc>
      <image:title>Die Stadt der Architekten</image:title>
      <image:caption>Book cover of: Die Stadt der Architekten. By: Angelus Eisinger</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-capitalism-and-the-global-crisis-taylor-francis-ltd-9780415693424-stephen-j-ball</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415693424.jpg?v=1767770770</image:loc>
      <image:title>Education, Capitalism and the Global Crisis</image:title>
      <image:caption>Book cover of: Education, Capitalism and the Global Crisis. By: Stephen J. Ball</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-studies-taylor-francis-ltd-9781138957770-the-key-concepts-dave-trotman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138957770.jpg?v=1767770769</image:loc>
      <image:title>Education Studies</image:title>
      <image:caption>Book cover of: Education Studies. By: Dave Trotman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-der-buergerinitiativen-im-verfassungssystem-des-grundgesetzes-der-bundesrepublik-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820488234</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820488234.jpg?v=1767770773</image:loc>
      <image:title>Die Stellung der Buergerinitiativen im Verfassungssystem des Grundgesetzes der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Stellung der Buergerinitiativen im Verfassungssystem des Grundgesetzes der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-des-mit-der-mutter-nicht-verheirateten-vaters-bei-adoption-des-kindes-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631440193-familienrecht-und-verfassung-in-der-bundesrepublik-deutschland-und-in-den-vereinigten-staaten-von-am</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631440193.jpg?v=1767770771</image:loc>
      <image:title>Die Stellung des mit der Mutter nicht verheirateten Vaters bei Adoption des Kindes</image:title>
      <image:caption>Book cover of: Die Stellung des mit der Mutter nicht verheirateten Vaters bei Adoption des Kindes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-der-laender-in-der-entwicklungspolitik-der-bundesrepublik-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820499865-dargestellt-am-beispiel-des-landes-berlin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820499865.jpg?v=1767770769</image:loc>
      <image:title>Die Stellung der Laender in der Entwicklungspolitik der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Stellung der Laender in der Entwicklungspolitik der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-jobs-gap-taylor-francis-inc-9780813366296-underemployment-or-economic-democracy-livingstone-d-w</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780813366296.jpg?v=1767770771</image:loc>
      <image:title>Education-Jobs Gap</image:title>
      <image:caption>Book cover of: Education-Jobs Gap. By: Livingstone, D. W.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-studies-issues-and-critical-perspectives-open-university-press-9780335219728-derek-kassem</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780335219728.jpg?v=1767770771</image:loc>
      <image:title>Education Studies: Issues and Critical Perspectives</image:title>
      <image:caption>Book cover of: Education Studies: Issues and Critical Perspectives. By: Derek Kassem</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-der-handelsregistergerichte-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631322901-eine-rechtsvergleichende-untersuchung-zum-deutschen-spanischen-und-englischen-recht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631322901.jpg?v=1767770769</image:loc>
      <image:title>Die Stellung der Handelsregistergerichte</image:title>
      <image:caption>Book cover of: Die Stellung der Handelsregistergerichte</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staatsrechtliche-beschwerde-wegen-verletzung-von-konkordaten-peter-lang-international-academic-publishers-9783261000903-urs-vetsch</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261000903.jpg?v=1767770769</image:loc>
      <image:title>Die staatsrechtliche Beschwerde wegen Verletzung von Konkordaten</image:title>
      <image:caption>Book cover of: Die staatsrechtliche Beschwerde wegen Verletzung von Konkordaten. By: Urs Vetsch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staatstheorie-chateaubriands-im-spiegel-der-deutschen-konstitutionalismus-diskussion-peter-lang-gmbh-9783820402681</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820402681.jpg?v=1767770771</image:loc>
      <image:title>Die Staatstheorie Chateaubriands Im Spiegel Der Deutschen Konstitutionalismus-Diskussion</image:title>
      <image:caption>Book cover of: Die Staatstheorie Chateaubriands Im Spiegel Der Deutschen Konstitutionalismus-Diskussion</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staatsverschuldung-im-kontext-alternativer-wirtschaftspolitik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631408940-zur-erweiterung-des-finanzpolitischen-handlungsspielraums-des-staates-durch-alternative-finanzierungsstrategien</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631408940.jpg?v=1767770771</image:loc>
      <image:title>Die Staatsverschuldung im Kontext alternativer Wirtschaftspolitik</image:title>
      <image:caption>Book cover of: Die Staatsverschuldung im Kontext alternativer Wirtschaftspolitik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-drug-use-connection-taylor-francis-inc-9780805861716-how-successes-and-failures-in-school-relate-to-adolescent-smoking-drinking-drug-use-and-delinquency-jerald-g-bachman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805861716.jpg?v=1767770769</image:loc>
      <image:title>Education-Drug Use Connection</image:title>
      <image:caption>Book cover of: Education-Drug Use Connection. By: Jerald G. Bachman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-autonomy-and-democratic-citizenship-taylor-francis-ltd-9781138866690-philosophy-in-a-changing-world-david-bridges</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138866690.jpg?v=1767770770</image:loc>
      <image:title>Education, Autonomy and Democratic Citizenship</image:title>
      <image:caption>Book cover of: Education, Autonomy and Democratic Citizenship. By: David Bridges</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-des-insolvenzverwalters-nach-neuem-insolvenz-und-handelsrecht-unter-besonderer-beruecksichtigung-des-firmenrechts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631371145</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631371145.jpg?v=1767770770</image:loc>
      <image:title>Die Stellung des Insolvenzverwalters nach neuem Insolvenz- und Handelsrecht unter besonderer Beruecksichtigung des Firmenrechts</image:title>
      <image:caption>Book cover of: Die Stellung des Insolvenzverwalters nach neuem Insolvenz- und Handelsrecht unter besonderer Beruecksichtigung des Firmenrechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-der-militaerperson-im-politischen-und-gesellschaftlichen-system-oesterreichs-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631365267-peter-klincok</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631365267.jpg?v=1767770771</image:loc>
      <image:title>Die Stellung der Militaerperson im politischen und gesellschaftlichen System Oesterreichs</image:title>
      <image:caption>Book cover of: Die Stellung der Militaerperson im politischen und gesellschaftlichen System Oesterreichs. By: Peter Klincok</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-write-now-volume-ii-taylor-francis-ltd-9780367026462-top-strategies-for-improving-relationships-and-culture-jeffrey-zoul</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367026462.jpg?v=1767770768</image:loc>
      <image:title>Education Write Now, Volume II</image:title>
      <image:caption>Book cover of: Education Write Now, Volume II. By: Jeffrey Zoul</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-standortorientierung-auslaendischer-unternehmen-in-duesseldorf-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631444481</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631444481.jpg?v=1767770771</image:loc>
      <image:title>Die Standortorientierung auslaendischer Unternehmen in Duesseldorf</image:title>
      <image:caption>Book cover of: Die Standortorientierung auslaendischer Unternehmen in Duesseldorf</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-drug-use-connection-taylor-francis-inc-9780805861709-how-successes-and-failures-in-school-relate-to-adolescent-smoking-drinking-drug-use-and-delinquency-jerald-g-bachman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805861709.jpg?v=1767770769</image:loc>
      <image:title>Education-Drug Use Connection</image:title>
      <image:caption>Book cover of: Education-Drug Use Connection. By: Jerald G. Bachman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-studies-taylor-francis-ltd-9781138957824-the-key-concepts-dave-trotman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138957824.jpg?v=1767770770</image:loc>
      <image:title>Education Studies</image:title>
      <image:caption>Book cover of: Education Studies. By: Dave Trotman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-autonomy-and-critical-thinking-taylor-francis-ltd-9780415543927-christopher-winch</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415543927.jpg?v=1767770769</image:loc>
      <image:title>Education, Autonomy and Critical Thinking</image:title>
      <image:caption>Book cover of: Education, Autonomy and Critical Thinking. By: Christopher Winch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staats-und-verfassungslehre-carl-salomo-zachariaes-peter-lang-ag-9783631303801</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631303801.jpg?v=1767770772</image:loc>
      <image:title>Die Staats- Und Verfassungslehre Carl Salomo Zachariaes</image:title>
      <image:caption>Book cover of: Die Staats- Und Verfassungslehre Carl Salomo Zachariaes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staatshaftung-gegenueber-auslaendern-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631302958-zur-zulaessigkeit-normativer-haftungsausschluesse-gegenueber-auslaendern-im-recht-der-staatlichen-ersatzleistungen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631302958.jpg?v=1767770770</image:loc>
      <image:title>Die Staatshaftung gegenueber Auslaendern</image:title>
      <image:caption>Book cover of: Die Staatshaftung gegenueber Auslaendern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staatsrechtslehrer-an-der-universitaet-heidelberg-im-19-jahrhundert-lebensbilder-und-forschungsbeitraege-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820483468</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820483468.jpg?v=1767770770</image:loc>
      <image:title>Die Staatsrechtslehrer an der Universitaet Heidelberg im 19. Jahrhundert - Lebensbilder und Forschungsbeitraege</image:title>
      <image:caption>Book cover of: Die Staatsrechtslehrer an der Universitaet Heidelberg im 19. Jahrhundert - Lebensbilder und Forschungsbeitraege</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-under-siege-taylor-francis-ltd-9780710213181-the-conservative-liberal-and-radical-debate-over-schooling-stanl-aronowitz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780710213181.jpg?v=1767770771</image:loc>
      <image:title>Education Under Siege</image:title>
      <image:caption>Book cover of: Education Under Siege. By: Stanl Aronowitz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-studies-sage-publications-inc-9780761940500-essential-issues</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761940500.jpg?v=1767770770</image:loc>
      <image:title>Education Studies</image:title>
      <image:caption>Book cover of: Education Studies</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-der-europaeischen-zentralbank-ezb-und-der-nationalen-zentralbanken-in-der-wirtschafts-und-waehrungsunion-nach-dem-vertrag-von-maastricht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631338254</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631338254.jpg?v=1767770772</image:loc>
      <image:title>Die Stellung der Europaeischen Zentralbank (EZB) und der nationalen Zentralbanken in der Wirtschafts- und Waehrungsunion nach dem Vertrag von Maastricht</image:title>
      <image:caption>Book cover of: Die Stellung der Europaeischen Zentralbank (EZB) und der nationalen Zentralbanken in der Wirtschafts- und Waehrungsunion nach dem Vertrag von Maastricht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-under-siege-taylor-francis-ltd-9781138162150-the-conservative-liberal-and-radical-debate-over-schooling-stanley-aronowitz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138162150.jpg?v=1767770771</image:loc>
      <image:title>Education Under Siege</image:title>
      <image:caption>Book cover of: Education Under Siege. By: Stanley Aronowitz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staatsangehoerigkeit-als-anknuepfung-im-deutschen-ipr-peter-lang-ag-9783631373569-unter-besonderer-beruecksichtigung-des-gesetzes-zur-reform-des-staatsangehoerigkeitsrechts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631373569.jpg?v=1767770769</image:loc>
      <image:title>Die Staatsangehoerigkeit ALS Anknuepfung Im Deutschen Ipr</image:title>
      <image:caption>Book cover of: Die Staatsangehoerigkeit ALS Anknuepfung Im Deutschen Ipr</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-with-character-taylor-francis-ltd-9780415277792</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415277792.jpg?v=1767770772</image:loc>
      <image:title>Education with Character</image:title>
      <image:caption>Book cover of: Education with Character</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staatsanwaltschaft-organ-der-judikative-oder-exekutivbehoerde-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631316429-die-stellung-der-anklagebehoerde-und-die-gewaltenteilung-des-grundgesetzes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631316429.jpg?v=1767770772</image:loc>
      <image:title>Die Staatsanwaltschaft - Organ der Judikative oder Exekutivbehoerde?</image:title>
      <image:caption>Book cover of: Die Staatsanwaltschaft - Organ der Judikative oder Exekutivbehoerde?</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-stellung-berlins-im-bundesrat-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820412000</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820412000.jpg?v=1767770771</image:loc>
      <image:title>Die Stellung Berlins im Bundesrat</image:title>
      <image:caption>Book cover of: Die Stellung Berlins im Bundesrat</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staatliche-beeinflussung-des-eigenen-rohoelangebots-in-importabhaengigen-laendern-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820452396-eine-systematische-analyse-von-ziel-mittel-relationen-dokumentiert-am-beispiel-der-oelpolitik-der</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820452396.jpg?v=1767770770</image:loc>
      <image:title>Die staatliche Beeinflussung des eigenen Rohoelangebots in importabhaengigen Laendern</image:title>
      <image:caption>Book cover of: Die staatliche Beeinflussung des eigenen Rohoelangebots in importabhaengigen Laendern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-research-primer-john-wiley-sons-inc-9780787983239-how-to-understand-evaluate-and-use-it-patricia-a-lauer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780787983239.jpg?v=1767770770</image:loc>
      <image:title>Education Research Primer</image:title>
      <image:caption>Book cover of: Education Research Primer. By: Patricia A. Lauer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staatsanwaltschaftliche-verfahrenseinstellung-wegen-geringfuegigkeit-nach-153-153a-stpo-entscheidungsgrenzen-und-entscheidungskontrolle-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820414608</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820414608.jpg?v=1767770772</image:loc>
      <image:title>Die staatsanwaltschaftliche Verfahrenseinstellung wegen Geringfuegigkeit  nach  153, 153a StPO - Entscheidungsgrenzen und Entscheidungskontrolle</image:title>
      <image:caption>Book cover of: Die staatsanwaltschaftliche Verfahrenseinstellung wegen Geringfuegigkeit  nach  153, 153a StPO - Entscheidungsgrenzen und Entscheidungskontrolle</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-research-on-trial-taylor-francis-ltd-9780415989886-policy-reform-and-the-call-for-scientific-rigor</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415989886.jpg?v=1767770770</image:loc>
      <image:title>Education Research On Trial</image:title>
      <image:caption>Book cover of: Education Research On Trial</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-state-and-crisis-taylor-francis-ltd-9780415791311-a-marxist-perspective-madan-sarup</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415791311.jpg?v=1767770771</image:loc>
      <image:title>Education State and Crisis</image:title>
      <image:caption>Book cover of: Education State and Crisis. By: Madan Sarup</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-in-japan-taylor-francis-ltd-9781138173149-a-case-of-immobilist-politics-leonard-james-schoppa</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138173149.jpg?v=1767770771</image:loc>
      <image:title>Education Reform in Japan</image:title>
      <image:caption>Book cover of: Education Reform in Japan. By: Leonard James Schoppa</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-state-and-crisis-taylor-francis-ltd-9780415791366-a-marxist-perspective-madan-sarup</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415791366.jpg?v=1767770770</image:loc>
      <image:title>Education State and Crisis</image:title>
      <image:caption>Book cover of: Education State and Crisis. By: Madan Sarup</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-research-and-evaluation-for-policy-and-practice-taylor-francis-ltd-9780750701884</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750701884.jpg?v=1767770772</image:loc>
      <image:title>Education Research and Evaluation: For Policy and Practice?</image:title>
      <image:caption>Book cover of: Education Research and Evaluation: For Policy and Practice?</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-research-on-trial-taylor-francis-ltd-9780415989893-policy-reform-and-the-call-for-scientific-rigor-pamela-walters</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415989893.jpg?v=1767770771</image:loc>
      <image:title>Education Research On Trial</image:title>
      <image:caption>Book cover of: Education Research On Trial. By: Pamela Walters</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-since-1800-taylor-francis-ltd-9780415432672-ivor-morrish</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415432672.jpg?v=1767770770</image:loc>
      <image:title>Education Since 1800</image:title>
      <image:caption>Book cover of: Education Since 1800. By: Ivor Morrish</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sprachrubrik-in-der-literaturnaja-gazeta-von-1964-bis-1978-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876902555</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876902555.jpg?v=1767770773</image:loc>
      <image:title>Die Sprachrubrik in der &quot;Literaturnaja gazeta&quot; von 1964 bis 1978</image:title>
      <image:caption>Book cover of: Die Sprachrubrik in der &quot;Literaturnaja gazeta&quot; von 1964 bis 1978</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sprachliche-situation-an-hochschulen-des-maghreb-und-die-offizielle-sprachpolitik-eine-soziolinguistische-untersuchung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631481813</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631481813.jpg?v=1767770773</image:loc>
      <image:title>Die sprachliche Situation an Hochschulen des Maghreb und die offizielle Sprachpolitik - Eine soziolinguistische Untersuchung</image:title>
      <image:caption>Book cover of: Die sprachliche Situation an Hochschulen des Maghreb und die offizielle Sprachpolitik - Eine soziolinguistische Untersuchung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-in-japan-taylor-francis-ltd-9780415096003-a-case-of-immobilist-politics</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415096003.jpg?v=1767770772</image:loc>
      <image:title>Education Reform in Japan</image:title>
      <image:caption>Book cover of: Education Reform in Japan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staaten-suedosteuropas-und-die-europaeisch-atlantischen-strukturen-eine-bestandsaufnahme-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631743157</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631743157.jpg?v=1767770773</image:loc>
      <image:title>Die Staaten Suedosteuropas und die europaeisch-atlantischen Strukturen. Eine Bestandsaufnahme</image:title>
      <image:caption>Book cover of: Die Staaten Suedosteuropas und die europaeisch-atlantischen Strukturen. Eine Bestandsaufnahme</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-research-and-the-media-taylor-francis-inc-9780815355861-challenges-and-possibilities-aspa-baroutsis</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815355861.jpg?v=1767770773</image:loc>
      <image:title>Education Research and the Media</image:title>
      <image:caption>Book cover of: Education Research and the Media. By: Aspa Baroutsis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-to-better-their-world-teachers-college-press-9780807757901-unleashing-the-power-of-21st-century-kids-marc-prensky</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780807757901.jpg?v=1767770771</image:loc>
      <image:title>Education to Better Their World</image:title>
      <image:caption>Book cover of: Education to Better Their World. By: Marc Prensky</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-research-and-evaluation-for-policy-and-practice-taylor-francis-ltd-9780750701891-robert-burgess</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750701891.jpg?v=1767770771</image:loc>
      <image:title>Education Research and Evaluation: For Policy and Practice?</image:title>
      <image:caption>Book cover of: Education Research and Evaluation: For Policy and Practice?. By: Robert Burgess</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-since-1800-taylor-francis-ltd-9780415761741-ivor-morrish</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415761741.jpg?v=1767770769</image:loc>
      <image:title>Education Since 1800</image:title>
      <image:caption>Book cover of: Education Since 1800. By: Ivor Morrish</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staatensukzession-in-voelkerrechtliche-vertraege-unter-besonderer-beruecksichtigung-der-herstellung-der-staatlichen-einheit-deutschlands-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631449219</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631449219.jpg?v=1767770773</image:loc>
      <image:title>Die Staatensukzession in voelkerrechtliche Vertraege unter besonderer Beruecksichtigung der Herstellung der staatlichen Einheit Deutschlands</image:title>
      <image:caption>Book cover of: Die Staatensukzession in voelkerrechtliche Vertraege unter besonderer Beruecksichtigung der Herstellung der staatlichen Einheit Deutschlands</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sprachinhaltsanalytischen-angst-und-agressivitaetsskalen-nach-gottschalk-und-gleser-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631462805-konkurrente-validierung-behandlung-des-reaktivitaetsproblems-und-vorschlag-einer-kognitivistisc</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631462805.jpg?v=1767770773</image:loc>
      <image:title>Die sprachinhaltsanalytischen Angst- und Agressivitaetsskalen nach Gottschalk und Gleser</image:title>
      <image:caption>Book cover of: Die sprachinhaltsanalytischen Angst- und Agressivitaetsskalen nach Gottschalk und Gleser</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sprache-franzoesischer-schueler-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631471357-schulspezifische-designate-und-ihre-bezeichnung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631471357.jpg?v=1767770774</image:loc>
      <image:title>Die Sprache franzoesischer Schueler</image:title>
      <image:caption>Book cover of: Die Sprache franzoesischer Schueler</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sprach-farbbild-transformation-in-der-kommunikativen-erziehung-hoergeschaedigter-vorschulkinder-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631442906</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631442906.jpg?v=1767770775</image:loc>
      <image:title>Die Sprach-Farbbild-Transformation in der kommunikativen Erziehung hoergeschaedigter Vorschulkinder</image:title>
      <image:caption>Book cover of: Die Sprach-Farbbild-Transformation in der kommunikativen Erziehung hoergeschaedigter Vorschulkinder</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sprache-des-artakserksovo-dejstvo-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876905556-studien-zur-sprachlichen-situation-im-ruland-des-ausgehenden-17-jahrhunderts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876905556.jpg?v=1767770771</image:loc>
      <image:title>Die Sprache des Artakserksovo dejstvo</image:title>
      <image:caption>Book cover of: Die Sprache des Artakserksovo dejstvo</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sprachliche-situation-in-der-slavia-zehn-jahre-nach-der-wende-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631368190-beitraege-zum-internationalen-symposion-des-slavischen-instituts-der-universitaet-heidelberg-vom-29-september-bis-2-o</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631368190.jpg?v=1767770774</image:loc>
      <image:title>Die sprachliche Situation in der Slavia zehn Jahre nach der Wende</image:title>
      <image:caption>Book cover of: Die sprachliche Situation in der Slavia zehn Jahre nach der Wende</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sportveranstaltungsausfallversicherung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631406892-peter-caninenberg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631406892.jpg?v=1767770774</image:loc>
      <image:title>Die Sportveranstaltungsausfallversicherung</image:title>
      <image:caption>Book cover of: Die Sportveranstaltungsausfallversicherung. By: Peter Caninenberg</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sprache-der-aeltesten-fassungen-des-libre-de-amich-e-amat-peter-lang-international-academic-publishers-9783261009623-untersuchungen-zur-kontrastiven-graphetik-phonetik-und-morphologie-des-katalanischen-und-des-provenzalischen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261009623.jpg?v=1767770772</image:loc>
      <image:title>Die Sprache der aeltesten Fassungen des «Libre de amich e amat»</image:title>
      <image:caption>Book cover of: Die Sprache der aeltesten Fassungen des «Libre de amich e amat»</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-research-and-the-media-taylor-francis-inc-9780815355885-challenges-and-possibilities-aspa-baroutsis</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815355885.jpg?v=1767770773</image:loc>
      <image:title>Education Research and the Media</image:title>
      <image:caption>Book cover of: Education Research and the Media. By: Aspa Baroutsis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-in-china-taylor-francis-ltd-9780415726146-changing-concepts-contexts-and-practices-janette-ryan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415726146.jpg?v=1767770771</image:loc>
      <image:title>Education Reform in China</image:title>
      <image:caption>Book cover of: Education Reform in China. By: Janette Ryan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-in-china-taylor-francis-ltd-9780415582230-changing-concepts-contexts-and-practices-janette-ryan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415582230.jpg?v=1767770773</image:loc>
      <image:title>Education Reform in China</image:title>
      <image:caption>Book cover of: Education Reform in China. By: Janette Ryan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-staatlichen-interventionen-im-fremdenverkehr-peter-lang-international-academic-publishers-9783261001375-begruendung-formen-und-ausmass-der-interventionen-in-ausgewaehlten-laendern-peter-h-berlin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261001375.jpg?v=1767770773</image:loc>
      <image:title>Die staatlichen Interventionen im Fremdenverkehr</image:title>
      <image:caption>Book cover of: Die staatlichen Interventionen im Fremdenverkehr. By: Peter Häberlin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-and-social-class-in-japan-taylor-francis-ltd-9781138851771-the-emerging-incentive-divide-takehiko-kariya</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138851771.jpg?v=1767770772</image:loc>
      <image:title>Education Reform and Social Class in Japan</image:title>
      <image:caption>Book cover of: Education Reform and Social Class in Japan. By: Takehiko Kariya</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-and-the-concept-of-good-teaching-taylor-francis-ltd-9781138657830-derek-gottlieb</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138657830.jpg?v=1767770773</image:loc>
      <image:title>Education Reform and the Concept of Good Teaching</image:title>
      <image:caption>Book cover of: Education Reform and the Concept of Good Teaching. By: Derek Gottlieb</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-in-contemporary-spain-taylor-francis-ltd-9780415091480</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415091480.jpg?v=1767770775</image:loc>
      <image:title>Education Reform in Contemporary Spain</image:title>
      <image:caption>Book cover of: Education Reform in Contemporary Spain</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-and-social-class-in-japan-taylor-francis-ltd-9780415556873-the-emerging-incentive-divide-takehiko-kariya</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415556873.jpg?v=1767770771</image:loc>
      <image:title>Education Reform and Social Class in Japan</image:title>
      <image:caption>Book cover of: Education Reform and Social Class in Japan. By: Takehiko Kariya</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-spielregeln-des-miteinanders-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906766652-jack-hibberds-dramatisches-werk-juliane-lochner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906766652.jpg?v=1767770773</image:loc>
      <image:title>Die Spielregeln des Miteinanders</image:title>
      <image:caption>Book cover of: Die Spielregeln des Miteinanders. By: Juliane Lochner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-and-the-concept-of-good-teaching-taylor-francis-ltd-9781138776241-derek-gottlieb</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138776241.jpg?v=1767770773</image:loc>
      <image:title>Education Reform and the Concept of Good Teaching</image:title>
      <image:caption>Book cover of: Education Reform and the Concept of Good Teaching. By: Derek Gottlieb</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-open-university-press-9780335192724</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780335192724.jpg?v=1767770774</image:loc>
      <image:title>EDUCATION REFORM</image:title>
      <image:caption>Book cover of: EDUCATION REFORM</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sprach-der-waja-nyan-wiyau-peter-lang-ag-9783631445747-phonologie-und-morphologie</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631445747.jpg?v=1767770775</image:loc>
      <image:title>Die Sprach Der Waja (Nyan Wiyau)</image:title>
      <image:caption>Book cover of: Die Sprach Der Waja (Nyan Wiyau)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sperre-des-gluecksspielers-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631351826</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631351826.jpg?v=1767770773</image:loc>
      <image:title>Die Sperre des Gluecksspielers</image:title>
      <image:caption>Book cover of: Die Sperre des Gluecksspielers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-and-social-change-taylor-francis-inc-9780805822519-multicultural-voices-struggles-and-visions-catherine-e-walsh</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805822519.jpg?v=1767770773</image:loc>
      <image:title>Education Reform and Social Change</image:title>
      <image:caption>Book cover of: Education Reform and Social Change. By: Catherine E. Walsh</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reconfigured-taylor-francis-ltd-9780415889629-culture-encounter-and-change-jane-roland-martin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415889629.jpg?v=1767770775</image:loc>
      <image:title>Education Reconfigured</image:title>
      <image:caption>Book cover of: Education Reconfigured. By: Jane Roland Martin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sphaere-der-offenkundigkeit-in-der-strafprozessordnung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631406427-die-offenkundigkeit-als-beweisablehnungsgrund-als-von-amts-wegen-zu-beachtender-umstand-und-als-pruefungskriterium-bei-der-u</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631406427.jpg?v=1767770775</image:loc>
      <image:title>Die Sphaere der Offenkundigkeit in der Strafprozessordnung</image:title>
      <image:caption>Book cover of: Die Sphaere der Offenkundigkeit in der Strafprozessordnung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-spanische-gmbh-peter-lang-ag-9783631332795-zweisprachige-textausgabe-des-spanischen-gmbh-gesetzes-vom-23-maerz-1995-mit-umfassender-einfuehrender-kommentierung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631332795.jpg?v=1767770774</image:loc>
      <image:title>Die Spanische Gmbh</image:title>
      <image:caption>Book cover of: Die Spanische Gmbh</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-spanische-aktiengesellschaft-im-18-jahrhundert-und-unter-dem-codigo-de-comercio-von-1829-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631346747</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631346747.jpg?v=1767770776</image:loc>
      <image:title>Die spanische Aktiengesellschaft im 18. Jahrhundert und unter dem Codigo de Comercio von 1829</image:title>
      <image:caption>Book cover of: Die spanische Aktiengesellschaft im 18. Jahrhundert und unter dem Codigo de Comercio von 1829</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-spaltung-von-kapitalgesellschaften-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631416457-ein-problemorientierter-diskussionsbeitrag-unter-beruecksichtigung-von-loesungen-in-anderen-laendern</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631416457.jpg?v=1767770773</image:loc>
      <image:title>Die Spaltung von Kapitalgesellschaften</image:title>
      <image:caption>Book cover of: Die Spaltung von Kapitalgesellschaften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-and-education-policy-in-east-asia-taylor-francis-ltd-9780415368148</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415368148.jpg?v=1767770774</image:loc>
      <image:title>Education Reform and Education Policy in East Asia</image:title>
      <image:caption>Book cover of: Education Reform and Education Policy in East Asia</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-and-social-change-taylor-francis-inc-9780805822526-multicultural-voices-struggles-and-visions-catherine-e-walsh</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805822526.jpg?v=1767770777</image:loc>
      <image:title>Education Reform and Social Change</image:title>
      <image:caption>Book cover of: Education Reform and Social Change. By: Catherine E. Walsh</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-psychology-taylor-francis-ltd-9781138875197-briefer-course-edward-l-thorndike</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138875197.jpg?v=1767770778</image:loc>
      <image:title>Education Psychology</image:title>
      <image:caption>Book cover of: Education Psychology. By: Edward L. Thorndike</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reform-and-education-policy-in-east-asia-taylor-francis-ltd-9780415647403-ka-ho-mok</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415647403.jpg?v=1767770777</image:loc>
      <image:title>Education Reform and Education Policy in East Asia</image:title>
      <image:caption>Book cover of: Education Reform and Education Policy in East Asia. By: Ka-Ho Mok</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-spirale-der-poesie-die-russische-dichtung-seit-1945-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631740590-uebersetzung-und-anhang-von-bernd-scholz-zdenek-mathauser</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631740590.jpg?v=1767770774</image:loc>
      <image:title>Die Spirale der Poesie: die russische Dichtung seit 1945</image:title>
      <image:caption>Book cover of: Die Spirale der Poesie: die russische Dichtung seit 1945. By: Zdenek Mathauser</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-soziomoralische-urteilsentwicklung-psychisch-gestoerter-jugendlicher-im-biographischen-kontext-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631303481</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631303481.jpg?v=1767770773</image:loc>
      <image:title>Die soziomoralische Urteilsentwicklung psychisch gestoerter Jugendlicher im biographischen Kontext</image:title>
      <image:caption>Book cover of: Die soziomoralische Urteilsentwicklung psychisch gestoerter Jugendlicher im biographischen Kontext</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-spd-als-friedenspartei-mehr-als-nur-wahltaktik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631430590-auswirkungen-sozialdemokratischer-traditionen-auf-die-friedenspolitischen-diskussionen-1959-1983</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631430590.jpg?v=1767770775</image:loc>
      <image:title>Die SPD als «Friedenspartei» - mehr als nur Wahltaktik?</image:title>
      <image:caption>Book cover of: Die SPD als «Friedenspartei» - mehr als nur Wahltaktik?</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-soziolinguistische-status-und-funktionsproblematik-von-reduktionssprachen-peter-lang-international-academic-publishers-9783261017925</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261017925.jpg?v=1767770775</image:loc>
      <image:title>Die soziolinguistische Status- und Funktionsproblematik von Reduktionssprachen</image:title>
      <image:caption>Book cover of: Die soziolinguistische Status- und Funktionsproblematik von Reduktionssprachen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-soziale-lage-alleinstehender-aelterer-frauen-in-grossstaedten-aus-drei-westeuropaeischen-laendern-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820458060-ergebnisse-einer-internationalen-vergleichsstudie-aus-der-bundesrepublik-deutschl</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820458060.jpg?v=1767770775</image:loc>
      <image:title>Die soziale Lage alleinstehender aelterer Frauen in Grossstaedten aus drei westeuropaeischen Laendern</image:title>
      <image:caption>Book cover of: Die soziale Lage alleinstehender aelterer Frauen in Grossstaedten aus drei westeuropaeischen Laendern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-spaltung-von-kapitalgesellschaften-nach-neuem-umwstg-in-ertragsteuerrechtlicher-und-betriebswirtschaftlicher-sicht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631323885</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631323885.jpg?v=1767770775</image:loc>
      <image:title>Die Spaltung von Kapitalgesellschaften nach neuem UmwStG in ertragsteuerrechtlicher und betriebswirtschaftlicher Sicht</image:title>
      <image:caption>Book cover of: Die Spaltung von Kapitalgesellschaften nach neuem UmwStG in ertragsteuerrechtlicher und betriebswirtschaftlicher Sicht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-soziooekonomie-der-chronischen-lebererkrankungen-in-deutschland-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906752143</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906752143.jpg?v=1767770775</image:loc>
      <image:title>Die Soziooekonomie der chronischen Lebererkrankungen in Deutschland</image:title>
      <image:caption>Book cover of: Die Soziooekonomie der chronischen Lebererkrankungen in Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-quality-and-social-justice-in-the-global-south-taylor-francis-ltd-9780415603546-challenges-for-policy-practice-and-research-leon-tikly</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415603546.jpg?v=1767770778</image:loc>
      <image:title>Education Quality and Social Justice in the Global South</image:title>
      <image:caption>Book cover of: Education Quality and Social Justice in the Global South. By: Leon Tikly</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sowjetischen-einflustrategien-zur-verhinderung-des-vollzugs-des-nato-doppelbeschlues-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631435311</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631435311.jpg?v=1767770775</image:loc>
      <image:title>Die sowjetischen Einflustrategien zur Verhinderung des Vollzugs des NATO-Doppelbeschlues</image:title>
      <image:caption>Book cover of: Die sowjetischen Einflustrategien zur Verhinderung des Vollzugs des NATO-Doppelbeschlues</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-making-in-wales-university-of-wales-press-9780708316320-explorations-in-devolved-governance</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780708316320.jpg?v=1767770776</image:loc>
      <image:title>Education Policy-Making in Wales</image:title>
      <image:caption>Book cover of: Education Policy-Making in Wales</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sozialkritik-des-li-chih-1527-1602-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820459081-am-beispiel-seiner-einstellung-zur-frau</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820459081.jpg?v=1767770778</image:loc>
      <image:title>Die Sozialkritik des Li Chih (1527-1602)</image:title>
      <image:caption>Book cover of: Die Sozialkritik des Li Chih (1527-1602)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-in-developing-countries-the-university-of-chicago-press-9780226078717</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226078717.jpg?v=1767770774</image:loc>
      <image:title>Education Policy in Developing Countries</image:title>
      <image:caption>Book cover of: Education Policy in Developing Countries</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-implementation-state-university-of-new-york-press-9780791406663</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-perils-taylor-francis-ltd-9781138898189-tackling-tough-issues-christopher-h-tienken</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138898189.jpg?v=1767770775</image:loc>
      <image:title>Education Policy Perils</image:title>
      <image:caption>Book cover of: Education Policy Perils. By: Christopher H. Tienken</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-psychology-taylor-francis-ltd-9780415210119-briefer-course-edward-l-thorndike</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415210119.jpg?v=1767770777</image:loc>
      <image:title>Education Psychology</image:title>
      <image:caption>Book cover of: Education Psychology. By: Edward L. Thorndike</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-reconfigured-taylor-francis-ltd-9780415889636-culture-encounter-and-change-jane-roland-martin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415889636.jpg?v=1767770778</image:loc>
      <image:title>Education Reconfigured</image:title>
      <image:caption>Book cover of: Education Reconfigured. By: Jane Roland Martin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-in-developing-countries-the-university-of-chicago-press-9780226078687-paul-glewwe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226078687.jpg?v=1767770776</image:loc>
      <image:title>Education Policy in Developing Countries</image:title>
      <image:caption>Book cover of: Education Policy in Developing Countries. By: Paul Glewwe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-space-and-the-city-taylor-francis-ltd-9781138021747-markets-and-the-in-visibility-of-race-kalervo-n-gulson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138021747.jpg?v=1767770777</image:loc>
      <image:title>Education Policy, Space and the City</image:title>
      <image:caption>Book cover of: Education Policy, Space and the City. By: Kalervo N. Gulson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-quality-and-social-justice-in-the-global-south-taylor-francis-ltd-9781138929302-challenges-for-policy-practice-and-research-leon-tikly</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138929302.jpg?v=1767770777</image:loc>
      <image:title>Education Quality and Social Justice in the Global South</image:title>
      <image:caption>Book cover of: Education Quality and Social Justice in the Global South. By: Leon Tikly</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sowjetische-staatsbuergerschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820471328-insbesondere-ihr-erwerb-und-verlust</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820471328.jpg?v=1767770774</image:loc>
      <image:title>Die sowjetische Staatsbuergerschaft</image:title>
      <image:caption>Book cover of: Die sowjetische Staatsbuergerschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-making-in-england-and-wales-taylor-francis-ltd-9780713002003-the-crucible-years-1895-1911</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780713002003.jpg?v=1767770776</image:loc>
      <image:title>Education Policy Making in England and Wales</image:title>
      <image:caption>Book cover of: Education Policy Making in England and Wales</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-space-and-the-city-taylor-francis-ltd-9780415995566-markets-and-the-in-visibility-of-race-kalervo-n-gulson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415995566.jpg?v=1767770777</image:loc>
      <image:title>Education Policy, Space and the City</image:title>
      <image:caption>Book cover of: Education Policy, Space and the City. By: Kalervo N. Gulson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-souveraenitaet-der-bundesrepublik-deutschland-und-die-integration-der-europaeischen-gemeinschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631477496-konsequenzen-der-deutschen-vereinigung-fuer-eine-kuenftige-europaeische-union-im-s</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631477496.jpg?v=1767770776</image:loc>
      <image:title>Die Souveraenitaet der Bundesrepublik Deutschland und die Integration der Europaeischen Gemeinschaft</image:title>
      <image:caption>Book cover of: Die Souveraenitaet der Bundesrepublik Deutschland und die Integration der Europaeischen Gemeinschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-perils-taylor-francis-ltd-9781138898196-tackling-tough-issues-christopher-h-tienken</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138898196.jpg?v=1767770776</image:loc>
      <image:title>Education Policy Perils</image:title>
      <image:caption>Book cover of: Education Policy Perils. By: Christopher H. Tienken</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sozialrechtliche-stellung-des-asylbewerbers-in-frankreich-und-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631334898</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631334898.jpg?v=1767770777</image:loc>
      <image:title>Die sozialrechtliche Stellung des Asylbewerbers in Frankreich und Deutschland</image:title>
      <image:caption>Book cover of: Die sozialrechtliche Stellung des Asylbewerbers in Frankreich und Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-and-social-class-taylor-francis-ltd-9780415363976-the-selected-works-of-stephen-j-ball</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415363976.jpg?v=1767770777</image:loc>
      <image:title>Education Policy and Social Class</image:title>
      <image:caption>Book cover of: Education Policy and Social Class</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-making-in-england-and-wales-taylor-francis-ltd-9781138968417-the-crucible-years-1895-1911-neil-daglish</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138968417.jpg?v=1767770774</image:loc>
      <image:title>Education Policy Making in England and Wales</image:title>
      <image:caption>Book cover of: Education Policy Making in England and Wales. By: Neil Daglish</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sowjetische-kolchos-und-dorfprosa-der-fuenfziger-und-sechziger-jahre-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876902531-zur-evolution-einer-literarischen-unterreihe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876902531.jpg?v=1767770776</image:loc>
      <image:title>Die sowjetische Kolchos- und Dorfprosa der fuenfziger und sechziger Jahre</image:title>
      <image:caption>Book cover of: Die sowjetische Kolchos- und Dorfprosa der fuenfziger und sechziger Jahre</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-soziale-konstruktion-von-aids-zwischen-exotik-und-integritaet-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631351192-eine-untersuchung-zu-aufklaerungsmaterialien-in-westeuropa-und-suedostasien-mark-rothensee</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631351192.jpg?v=1767770775</image:loc>
      <image:title>Die soziale Konstruktion von AIDS zwischen Exotik und Integritaet</image:title>
      <image:caption>Book cover of: Die soziale Konstruktion von AIDS zwischen Exotik und Integritaet. By: Mark Rothensee</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-and-social-reproduction-taylor-francis-ltd-9780415240055-class-inscription-symbolic-control-john-fitz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415240055.jpg?v=1767770777</image:loc>
      <image:title>Education Policy and Social Reproduction</image:title>
      <image:caption>Book cover of: Education Policy and Social Reproduction. By: John Fitz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-and-social-class-taylor-francis-ltd-9780415363983-the-selected-works-of-stephen-j-ball</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415363983.jpg?v=1767770776</image:loc>
      <image:title>Education Policy and Social Class</image:title>
      <image:caption>Book cover of: Education Policy and Social Class</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sonderschule-fuer-sprachbehinderte-im-verdichtungsraum-bremen-und-ihre-verflechtungen-mit-den-niedersaechsischen-gemeinden-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631422885</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631422885.jpg?v=1767770776</image:loc>
      <image:title>Die Sonderschule fuer Sprachbehinderte im Verdichtungsraum Bremen und ihre Verflechtungen mit den niedersaechsischen Gemeinden</image:title>
      <image:caption>Book cover of: Die Sonderschule fuer Sprachbehinderte im Verdichtungsraum Bremen und ihre Verflechtungen mit den niedersaechsischen Gemeinden</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sonderregelungen-fuer-die-neuen-bundeslaender-in-246-a-baugb-und-im-manahmengesetz-zum-baugesetzbuch-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631312070</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631312070.jpg?v=1767770778</image:loc>
      <image:title>Die Sonderregelungen fuer die neuen Bundeslaender in  246 a BauGB und im Manahmengesetz zum Baugesetzbuch</image:title>
      <image:caption>Book cover of: Die Sonderregelungen fuer die neuen Bundeslaender in  246 a BauGB und im Manahmengesetz zum Baugesetzbuch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sowjetische-geschichtswissenschaft-1953-bis-1991-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876905754-studien-zur-methodologie-und-organisationsgeschichte</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876905754.jpg?v=1767770776</image:loc>
      <image:title>Die sowjetische Geschichtswissenschaft 1953 bis 1991</image:title>
      <image:caption>Book cover of: Die sowjetische Geschichtswissenschaft 1953 bis 1991</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sogenannten-durchgriffstatbestaende-im-privatrecht-als-problem-einer-interessengerechten-risikoverteilung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820454949</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820454949.jpg?v=1767770777</image:loc>
      <image:title>Die sogenannten Durchgriffstatbestaende im Privatrecht als Problem einer interessengerechten Risikoverteilung</image:title>
      <image:caption>Book cover of: Die sogenannten Durchgriffstatbestaende im Privatrecht als Problem einer interessengerechten Risikoverteilung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-and-practice-harvard-educational-review-u-s-9780916690403-bridging-the-divide</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780916690403.jpg?v=1767770778</image:loc>
      <image:title>Education Policy and Practice</image:title>
      <image:caption>Book cover of: Education Policy and Practice</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-analysis-for-a-complex-world-taylor-francis-ltd-9780367030179-poststructural-possibilities-kalervo-n-gulson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367030179.jpg?v=1767770777</image:loc>
      <image:title>Education Policy Analysis for a Complex World</image:title>
      <image:caption>Book cover of: Education Policy Analysis for a Complex World. By: Kalervo N. Gulson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sophia-lehre-bei-klemens-von-alexandrien-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820470017-eine-paedagogisch-anthropologische-untersuchung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820470017.jpg?v=1767770778</image:loc>
      <image:title>Die Sophia-Lehre bei Klemens von Alexandrien</image:title>
      <image:caption>Book cover of: Die Sophia-Lehre bei Klemens von Alexandrien</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-and-realist-social-theory-taylor-francis-ltd-9780415464338-primary-teachers-child-centred-philosophy-and-the-new-managerialism-robert-wilmott</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415464338.jpg?v=1767770777</image:loc>
      <image:title>Education Policy and Realist Social Theory</image:title>
      <image:caption>Book cover of: Education Policy and Realist Social Theory. By: Robert Wilmott</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-solvabilitaet-deutscher-lebensversicherungsunternehmen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820451740</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820451740.jpg?v=1767770778</image:loc>
      <image:title>Die Solvabilitaet deutscher Lebensversicherungsunternehmen</image:title>
      <image:caption>Book cover of: Die Solvabilitaet deutscher Lebensversicherungsunternehmen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sogenannte-vermummung-und-passive-bewaffnung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631404799-verfassungs-und-verwaltungsrechtliche-probleme-unter-besonderer-beruecksichtigung-der-aenderung-des-versammlungsgesetzes-von-1985</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631404799.jpg?v=1767770777</image:loc>
      <image:title>Die sogenannte Vermummung und passive Bewaffnung</image:title>
      <image:caption>Book cover of: Die sogenannte Vermummung und passive Bewaffnung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-and-realist-social-theory-taylor-francis-ltd-9780415268394-primary-teachers-child-centred-philosophy-and-the-new-managerialism-robert-wilmott</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415268394.jpg?v=1767770776</image:loc>
      <image:title>Education Policy and Realist Social Theory</image:title>
      <image:caption>Book cover of: Education Policy and Realist Social Theory. By: Robert Wilmott</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-4-vol-set-taylor-francis-ltd-9781138827813-stephen-ball</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138827813.jpg?v=1767770779</image:loc>
      <image:title>Education Policy (4-vol. set)</image:title>
      <image:caption>Book cover of: Education Policy (4-vol. set). By: Stephen Ball</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-slavischen-nomina-auf-ba-peter-lang-international-academic-publishers-9783261013149</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261013149.jpg?v=1767770777</image:loc>
      <image:title>Die slavischen Nomina auf -ba</image:title>
      <image:caption>Book cover of: Die slavischen Nomina auf -ba</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sorgfaltspflichten-im-lebensmittelstraf-und-ordnungswidrigkeitenrecht-unter-besonderer-beruecksichtigung-der-europarechtlichen-ueberlagerung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631324745-eine-untersuchung-ueber-die-moeglichke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631324745.jpg?v=1767770777</image:loc>
      <image:title>Die Sorgfaltspflichten im Lebensmittelstraf- und Ordnungswidrigkeitenrecht unter besonderer Beruecksichtigung der europarechtlichen Ueberlagerung</image:title>
      <image:caption>Book cover of: Die Sorgfaltspflichten im Lebensmittelstraf- und Ordnungswidrigkeitenrecht unter besonderer Beruecksichtigung der europarechtlichen Ueberlagerung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sogenannte-erweiterte-belehrungspflicht-des-notars-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631424612</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631424612.jpg?v=1767770778</image:loc>
      <image:title>Die sogenannte erweiterte Belehrungspflicht des Notars</image:title>
      <image:caption>Book cover of: Die sogenannte erweiterte Belehrungspflicht des Notars</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-analysis-for-a-complex-world-taylor-francis-ltd-9781138241268-poststructural-possibilities-kalervo-n-gulson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138241268.jpg?v=1767770775</image:loc>
      <image:title>Education Policy Analysis for a Complex World</image:title>
      <image:caption>Book cover of: Education Policy Analysis for a Complex World. By: Kalervo N. Gulson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sorge-der-eltern-fuer-ihre-kinder-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631448939-rechtsvergleichende-gegenueberstellung-der-oesterreichischen-und-der-deutschen-rechtslage</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631448939.jpg?v=1767770779</image:loc>
      <image:title>Die Sorge der Eltern fuer ihre Kinder</image:title>
      <image:caption>Book cover of: Die Sorge der Eltern fuer ihre Kinder</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-and-equal-opportunity-in-japan-berghahn-books-9780857452672-akito-okada</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780857452672.jpg?v=1767770777</image:loc>
      <image:title>Education Policy and Equal Opportunity in Japan</image:title>
      <image:caption>Book cover of: Education Policy and Equal Opportunity in Japan. By: Akito Okada</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-soziale-frage-im-spannungsfeld-von-spaetaufklaerung-und-vormaerz-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820412093</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820412093.jpg?v=1767770776</image:loc>
      <image:title>Die soziale Frage im Spannungsfeld von Spaetaufklaerung und Vormaerz</image:title>
      <image:caption>Book cover of: Die soziale Frage im Spannungsfeld von Spaetaufklaerung und Vormaerz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-and-contemporary-theory-taylor-francis-ltd-9780415736558-implications-for-research</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415736558.jpg?v=1767770778</image:loc>
      <image:title>Education Policy and Contemporary Theory</image:title>
      <image:caption>Book cover of: Education Policy and Contemporary Theory</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-and-contemporary-theory-taylor-francis-ltd-9780415736565-implications-for-research</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415736565.jpg?v=1767770780</image:loc>
      <image:title>Education Policy and Contemporary Theory</image:title>
      <image:caption>Book cover of: Education Policy and Contemporary Theory</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-and-social-reproduction-taylor-francis-ltd-9780415240048-class-inscription-symbolic-control-john-fitz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415240048.jpg?v=1767770778</image:loc>
      <image:title>Education Policy and Social Reproduction</image:title>
      <image:caption>Book cover of: Education Policy and Social Reproduction. By: John Fitz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-sage-publications-ltd-9780857025777-ian-abbott</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780857025777.jpg?v=1767770779</image:loc>
      <image:title>Education Policy</image:title>
      <image:caption>Book cover of: Education Policy. By: Ian Abbott</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-taylor-francis-ltd-9780415377713-process-themes-and-impact-h-stevenson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415377713.jpg?v=1767770780</image:loc>
      <image:title>Education Policy</image:title>
      <image:caption>Book cover of: Education Policy. By: H. Stevenson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sicherungsuebereignung-in-einzelzwangsvollstreckung-und-insolvenz-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631306017-eine-analyse-der-insolvenzrechtlichen-neuregelung-der-51-166-ff-inso-und-ihrer-auswirkungen-auf-die-einzelzwangsv</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631306017.jpg?v=1767770780</image:loc>
      <image:title>Die Sicherungsuebereignung in Einzelzwangsvollstreckung und Insolvenz</image:title>
      <image:caption>Book cover of: Die Sicherungsuebereignung in Einzelzwangsvollstreckung und Insolvenz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-taylor-francis-ltd-9780415377720-process-themes-and-impact-h-stevenson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415377720.jpg?v=1767770778</image:loc>
      <image:title>Education Policy</image:title>
      <image:caption>Book cover of: Education Policy. By: H. Stevenson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-sage-publications-inc-9780761974703-globalization-citizenship-and-democracy-mark-olssen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761974703.jpg?v=1767770779</image:loc>
      <image:title>Education Policy</image:title>
      <image:caption>Book cover of: Education Policy. By: Mark Olssen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-siedlungsstrukturen-der-privaten-haushalte-in-potsdam-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631386767-wolfgang-wagner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631386767.jpg?v=1767770777</image:loc>
      <image:title>Die Siedlungsstrukturen der privaten Haushalte in Potsdam</image:title>
      <image:caption>Book cover of: Die Siedlungsstrukturen der privaten Haushalte in Potsdam. By: Wolfgang Wagner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sicherung-qualifizierter-unternehmensleitung-beim-einzelkaufmaennischen-unternehmen-ueber-den-tod-hinaus-peter-lang-ag-9783631340523</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631340523.jpg?v=1767770778</image:loc>
      <image:title>Die Sicherung Qualifizierter Unternehmensleitung Beim Einzelkaufmaennischen Unternehmen Ueber Den Tod Hinaus</image:title>
      <image:caption>Book cover of: Die Sicherung Qualifizierter Unternehmensleitung Beim Einzelkaufmaennischen Unternehmen Ueber Den Tod Hinaus</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sicherung-der-bauunternehmer-nach-648-a-bgb-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631362242-unter-besonderer-beruecksichtigung-der-vereinbarkeit-der-regelung-mit-den-prinzipien-des-zivilrechts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631362242.jpg?v=1767770780</image:loc>
      <image:title>Die Sicherung der Bauunternehmer nach  648 a BGB</image:title>
      <image:caption>Book cover of: Die Sicherung der Bauunternehmer nach  648 a BGB</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sorgfaltspflicht-der-arbeitnehmervertreter-im-aufsichtsrat-peter-lang-ag-9783631348017-renate-alversammer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631348017.jpg?v=1767770778</image:loc>
      <image:title>Die Sorgfaltspflicht Der Arbeitnehmervertreter Im Aufsichtsrat</image:title>
      <image:caption>Book cover of: Die Sorgfaltspflicht Der Arbeitnehmervertreter Im Aufsichtsrat. By: Renate Alversammer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-plc-taylor-francis-ltd-9780415399401-understanding-private-sector-participation-in-public-sector-education-stephen-ball-stephen-j-ball</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415399401.jpg?v=1767770779</image:loc>
      <image:title>Education plc</image:title>
      <image:caption>Book cover of: Education plc. By: Stephen Ball, Stephen J. Ball</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-sage-publications-inc-9780761974697-globalization-citizenship-and-democracy-mark-olssen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761974697.jpg?v=1767770778</image:loc>
      <image:title>Education Policy</image:title>
      <image:caption>Book cover of: Education Policy. By: Mark Olssen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-taylor-francis-ltd-9780415275545</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415275545.jpg?v=1767770778</image:loc>
      <image:title>EDUCATION POLICY</image:title>
      <image:caption>Book cover of: EDUCATION POLICY</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sich-aendernde-bedeutung-der-feindstaatenartikel-artikel-53-und-107-der-satzung-der-vereinten-nationen-fuer-deutschland-peter-lang-international-academic-publishers-9783261009999</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261009999.jpg?v=1767770782</image:loc>
      <image:title>Die sich aendernde Bedeutung der Feindstaatenartikel (Artikel 53 und 107 der Satzung der Vereinten Nationen) fuer Deutschland</image:title>
      <image:caption>Book cover of: Die sich aendernde Bedeutung der Feindstaatenartikel (Artikel 53 und 107 der Satzung der Vereinten Nationen) fuer Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-papers-taylor-francis-ltd-9780415606363-dale-spender</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415606363.jpg?v=1767770778</image:loc>
      <image:title>Education Papers</image:title>
      <image:caption>Book cover of: Education Papers. By: Dale Spender</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sicherstellung-gemeinwirtschaftlicher-leistungen-im-wettbewerbsorientierten-umfeld-der-europaeischen-union-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631373392-viktor-zorn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631373392.jpg?v=1767770777</image:loc>
      <image:title>Die Sicherstellung gemeinwirtschaftlicher Leistungen im wettbewerbsorientierten Umfeld der Europaeischen Union</image:title>
      <image:caption>Book cover of: Die Sicherstellung gemeinwirtschaftlicher Leistungen im wettbewerbsorientierten Umfeld der Europaeischen Union. By: Viktor Zorn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sicherstellung-gem-94-stpo-und-deren-foerderung-durch-die-inpflichtnahme-dritter-als-mittel-des-zugriffs-auf-elektronisch-gespeicherte-daten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631487846</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631487846.jpg?v=1767770781</image:loc>
      <image:title>Die Sicherstellung gem.  94 StPO und deren Foerderung durch die Inpflichtnahme Dritter als Mittel des Zugriffs auf elektronisch gespeicherte Daten</image:title>
      <image:caption>Book cover of: Die Sicherstellung gem.  94 StPO und deren Foerderung durch die Inpflichtnahme Dritter als Mittel des Zugriffs auf elektronisch gespeicherte Daten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-outcomes-and-poverty-taylor-francis-ltd-9780415533041-a-reassessment</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415533041.jpg?v=1767770779</image:loc>
      <image:title>Education Outcomes and Poverty</image:title>
      <image:caption>Book cover of: Education Outcomes and Poverty</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sicherungsbeschlagnahme-von-luftfahrzeugen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820411843</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820411843.jpg?v=1767770781</image:loc>
      <image:title>Die Sicherungsbeschlagnahme von Luftfahrzeugen</image:title>
      <image:caption>Book cover of: Die Sicherungsbeschlagnahme von Luftfahrzeugen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sittenwidrigkeit-von-verfuegungen-von-todes-wegen-in-historischer-sicht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631320310-die-entwicklung-der-gesetzgebung-und-der-hoechstrichterlichen-rechtsprechung-seit-der-entstehung-des-bgb-bi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631320310.jpg?v=1767770782</image:loc>
      <image:title>Die Sittenwidrigkeit von Verfuegungen von Todes wegen in historischer Sicht</image:title>
      <image:caption>Book cover of: Die Sittenwidrigkeit von Verfuegungen von Todes wegen in historischer Sicht. By: Oliver Karow</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-short-story-der-nineties-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820487626-narrative-kurzprosa-im-spannungsfeld-zwischen-aesthetizismus-und-naturalismus</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820487626.jpg?v=1767770781</image:loc>
      <image:title>Die Short Story der Nineties</image:title>
      <image:caption>Book cover of: Die Short Story der Nineties</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-outcomes-and-poverty-taylor-francis-ltd-9780415582025-a-reassessment-christopher-colclough</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415582025.jpg?v=1767770779</image:loc>
      <image:title>Education Outcomes and Poverty</image:title>
      <image:caption>Book cover of: Education Outcomes and Poverty. By: Christopher Colclough</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-semiologie-des-transparenten-gebaeudes-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631493069-raum-zeit-tod-bei-lesage-zola-butor-und-perec</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631493069.jpg?v=1767770780</image:loc>
      <image:title>Die Semiologie des transparenten Gebaeudes</image:title>
      <image:caption>Book cover of: Die Semiologie des transparenten Gebaeudes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-plc-taylor-francis-ltd-9780415399418-understanding-private-sector-participation-in-public-sector-education-stephen-j-ball-stephen-ball</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415399418.jpg?v=1767770780</image:loc>
      <image:title>Education plc</image:title>
      <image:caption>Book cover of: Education plc. By: Stephen J. Ball, Stephen Ball</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-the-poor-taylor-francis-ltd-9780415864770-the-history-of-the-national-school-1824-1974-pamela-silver</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415864770.jpg?v=1767770780</image:loc>
      <image:title>Education of the Poor</image:title>
      <image:caption>Book cover of: Education of the Poor. By: Pamela Silver</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-semantik-des-wortnestes-grad-gorod-im-altrussischen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631329238-unter-kontextuellem-wortbildendem-und-kulturellem-aspekt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631329238.jpg?v=1767770781</image:loc>
      <image:title>Die Semantik des Wortnestes «grad/gorod» im Altrussischen</image:title>
      <image:caption>Book cover of: Die Semantik des Wortnestes «grad/gorod» im Altrussischen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-policy-sage-publications-ltd-9780857025760-ian-abbott</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780857025760.jpg?v=1767770779</image:loc>
      <image:title>Education Policy</image:title>
      <image:caption>Book cover of: Education Policy. By: Ian Abbott</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-women-in-the-united-states-taylor-francis-inc-9780824048426-a-guide-to-theory-teaching-and-research</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780824048426.jpg?v=1767770779</image:loc>
      <image:title>Education of Women in the United States</image:title>
      <image:caption>Book cover of: Education of Women in the United States</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-papers-taylor-francis-ltd-9780415256865-dale-spender</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415256865.jpg?v=1767770780</image:loc>
      <image:title>Education Papers</image:title>
      <image:caption>Book cover of: Education Papers. By: Dale Spender</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-outreach-and-public-engagement-springer-verlag-new-york-inc-9780387777917-erin-l-dolan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780387777917.jpg?v=1767770780</image:loc>
      <image:title>Education Outreach and Public Engagement</image:title>
      <image:caption>Book cover of: Education Outreach and Public Engagement. By: Erin L. Dolan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-value-cambridge-university-press-9780521315159-the-purposes-and-practices-of-schools-marvin-lazerson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521315159.jpg?v=1767770780</image:loc>
      <image:title>Education of Value</image:title>
      <image:caption>Book cover of: Education of Value. By: Marvin Lazerson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-semantische-belastung-von-submorphematischen-einheiten-im-englischen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820477436-eine-empirisch-strukturelle-untersuchung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820477436.jpg?v=1767770782</image:loc>
      <image:title>Die semantische Belastung von submorphematischen Einheiten im Englischen</image:title>
      <image:caption>Book cover of: Die semantische Belastung von submorphematischen Einheiten im Englischen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-semantik-des-verbalaspekts-im-russischen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631480281</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631480281.jpg?v=1767770784</image:loc>
      <image:title>Die Semantik des Verbalaspekts im Russischen</image:title>
      <image:caption>Book cover of: Die Semantik des Verbalaspekts im Russischen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sequestration-im-konkursantragsverfahren-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631407356</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631407356.jpg?v=1767770780</image:loc>
      <image:title>Die Sequestration im Konkursantragsverfahren</image:title>
      <image:caption>Book cover of: Die Sequestration im Konkursantragsverfahren</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-women-in-the-united-states-taylor-francis-ltd-9781138968349-a-guide-to-theory-teaching-and-research-averil-evans-mcclelland</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138968349.jpg?v=1767770782</image:loc>
      <image:title>Education of Women in the United States</image:title>
      <image:caption>Book cover of: Education of Women in the United States. By: Averil Evans McClelland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-to-day-cambridge-university-press-9781107678286-e-d-laborde</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781107678286.jpg?v=1767770780</image:loc>
      <image:title>Education of To-Day</image:title>
      <image:caption>Book cover of: Education of To-Day. By: E. D. Laborde</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-selbstorganisation-von-unternehmen-in-strategischen-netzwerken-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631493472-bausteine-zu-einer-theorie-des-evolutionaeren-managements</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631493472.jpg?v=1767770780</image:loc>
      <image:title>Die Selbstorganisation von Unternehmen in strategischen Netzwerken</image:title>
      <image:caption>Book cover of: Die Selbstorganisation von Unternehmen in strategischen Netzwerken</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-the-people-taylor-francis-ltd-9780415860697-a-history-of-primary-education-in-england-and-wales-in-the-nineteenth-century-mary-sturt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415860697.jpg?v=1767770780</image:loc>
      <image:title>Education of the People</image:title>
      <image:caption>Book cover of: Education of the People. By: Mary Sturt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-selbst-bildung-und-der-exzess-des-blicks-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820499094-zum-werk-heinrich-von-kleists</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820499094.jpg?v=1767770781</image:loc>
      <image:title>Die Selbst-Bildung und der Exzess des Blicks</image:title>
      <image:caption>Book cover of: Die Selbst-Bildung und der Exzess des Blicks</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-semantik-des-textuellen-et-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820496604</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820496604.jpg?v=1767770782</image:loc>
      <image:title>Die Semantik des textuellen et</image:title>
      <image:caption>Book cover of: Die Semantik des textuellen et</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-ronald-reagan-columbia-university-press-9780231138611-the-general-electric-years-and-the-untold-story-of-his-conversion-to-conservatism-thomas-w-evans</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780231138611.jpg?v=1767770780</image:loc>
      <image:title>Education of Ronald Reagan</image:title>
      <image:caption>Book cover of: Education of Ronald Reagan. By: Thomas W. Evans</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-selbsthilfe-als-voraussetzung-staatlicher-hilfsmassnahmen-art-31-bis-abs-4-bv-peter-lang-international-academic-publishers-9783261000941-art-31-bis-abs-4-bv-ivan-thomas-locher</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261000941.jpg?v=1767770782</image:loc>
      <image:title>Die Selbsthilfe als Voraussetzung staatlicher Hilfsmassnahmen- (Art. 31 bis Abs. 4 BV)</image:title>
      <image:caption>Book cover of: Die Selbsthilfe als Voraussetzung staatlicher Hilfsmassnahmen- (Art. 31 bis Abs. 4 BV). By: Ivan Thomas Locher</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-the-poor-taylor-francis-ltd-9780415432870-the-history-of-the-national-school-1824-1974-harold-silver</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415432870.jpg?v=1767770780</image:loc>
      <image:title>Education of the Poor</image:title>
      <image:caption>Book cover of: Education of the Poor. By: Harold Silver</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-selbstdarstellung-der-bundesrepublik-deutschland-im-ausland-durch-den-rundfunk-als-problem-des-staats-und-voelkerrechts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820463576</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820463576.jpg?v=1767770781</image:loc>
      <image:title>Die Selbstdarstellung der Bundesrepublik Deutschland im Ausland durch den Rundfunk als Problem des Staats- und Voelkerrechts</image:title>
      <image:caption>Book cover of: Die Selbstdarstellung der Bundesrepublik Deutschland im Ausland durch den Rundfunk als Problem des Staats- und Voelkerrechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-segmentsysteme-des-deutschen-und-des-bulgarischen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876904450</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876904450.jpg?v=1767770780</image:loc>
      <image:title>Die Segmentsysteme des Deutschen und des Bulgarischen</image:title>
      <image:caption>Book cover of: Die Segmentsysteme des Deutschen und des Bulgarischen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sehnsucht-zu-sehen-peter-lang-ag-9783631451618-der-filmische-blick-auf-dem-theater-robert-wilsons-the-civil-wars</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631451618.jpg?v=1767770781</image:loc>
      <image:title>Die Sehnsucht zu sehen</image:title>
      <image:caption>Book cover of: Die Sehnsucht zu sehen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-senate-der-hansestaedte-hamburg-und-bremen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631418147-eine-verfassungsrechtliche-untersuchung-zum-parlamentarischen-regierungssystem-in-den-hansestaedten</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631418147.jpg?v=1767770783</image:loc>
      <image:title>Die Senate der Hansestaedte Hamburg und Bremen</image:title>
      <image:caption>Book cover of: Die Senate der Hansestaedte Hamburg und Bremen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sehnsucht-nach-den-anderen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820483895-eine-studie-zum-verhaeltnis-von-subjekt-und-gesellschaft-in-den-autobiographien-von-lillian-hellman-maya-angelou-und-maxine-hong-kingston</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820483895.jpg?v=1767770782</image:loc>
      <image:title>Die Sehnsucht nach den anderen</image:title>
      <image:caption>Book cover of: Die Sehnsucht nach den anderen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-sam-sanders-university-press-of-america-9780761834632-t-s-poetter</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761834632.jpg?v=1767770786</image:loc>
      <image:title>Education of Sam Sanders</image:title>
      <image:caption>Book cover of: Education of Sam Sanders. By: T. S. Poetter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sechsjaehrige-grundschule-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631487716-geschichtliche-entwicklung-und-gegenwaertige-gestalt-aus-paedagogischer-und-politischer-perspektive</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631487716.jpg?v=1767770780</image:loc>
      <image:title>Die sechsjaehrige Grundschule</image:title>
      <image:caption>Book cover of: Die sechsjaehrige Grundschule</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-ronald-reagan-columbia-university-press-9780231138604-the-general-electric-years-and-the-untold-story-of-his-conversion-to-conservatism-thomas-w-evans</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780231138604.jpg?v=1767770781</image:loc>
      <image:title>Education of Ronald Reagan</image:title>
      <image:caption>Book cover of: Education of Ronald Reagan. By: Thomas W. Evans</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-seheigenschaften-des-menschlichen-auges-als-beitrag-zum-problem-der-gutebeurteilung-von-projektions-und-fernsehbildern-springer-berlin-heidelberg-9783662115367-w-kroebel</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783662115367.jpg?v=1767770780</image:loc>
      <image:title>Die Seheigenschaften des menschlichen Auges als Beitrag zum Problem der Gutebeurteilung von Projektions- und Fernsehbildern</image:title>
      <image:caption>Book cover of: Die Seheigenschaften des menschlichen Auges als Beitrag zum Problem der Gutebeurteilung von Projektions- und Fernsehbildern. By: W. Kroebel</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-the-people-taylor-francis-ltd-9780415432887-a-history-of-primary-education-in-england-and-wales-in-the-nineteenth-century-mary-sturt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415432887.jpg?v=1767770780</image:loc>
      <image:title>Education of the People</image:title>
      <image:caption>Book cover of: Education of the People. By: Mary Sturt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-radical-democracy-taylor-francis-ltd-9780415702638-sarah-s-amsler</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415702638.jpg?v=1767770782</image:loc>
      <image:title>Education of Radical Democracy</image:title>
      <image:caption>Book cover of: Education of Radical Democracy. By: Sarah S. Amsler</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-radical-democracy-taylor-francis-inc-9780815356332-sarah-s-amsler</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815356332.jpg?v=1767770782</image:loc>
      <image:title>Education of Radical Democracy</image:title>
      <image:caption>Book cover of: Education of Radical Democracy. By: Sarah S. Amsler</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schweizerische-neutralitaet-in-bewaffneten-konflikten-nach-1945-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631452073</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631452073.jpg?v=1767770781</image:loc>
      <image:title>Die schweizerische Neutralitaet in bewaffneten Konflikten nach 1945</image:title>
      <image:caption>Book cover of: Die schweizerische Neutralitaet in bewaffneten Konflikten nach 1945</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schweiz-von-westen-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906769332-beitraege-zum-kulturellen-dialog</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906769332.jpg?v=1767770782</image:loc>
      <image:title>Die Schweiz von Westen</image:title>
      <image:caption>Book cover of: Die Schweiz von Westen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-selbstverwaltung-in-der-sozialversicherung-als-korporatistische-einrichtung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820472936-eine-politik-soziologische-analyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820472936.jpg?v=1767770781</image:loc>
      <image:title>Die Selbstverwaltung in der Sozialversicherung als korporatistische Einrichtung</image:title>
      <image:caption>Book cover of: Die Selbstverwaltung in der Sozialversicherung als korporatistische Einrichtung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schwangerschaft-einer-toten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631492482-strafrecht-an-der-grenze-von-leben-und-tod-der-erlanger-und-der-stuttgarter-baby-fall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631492482.jpg?v=1767770782</image:loc>
      <image:title>Die Schwangerschaft einer Toten</image:title>
      <image:caption>Book cover of: Die Schwangerschaft einer Toten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-syrian-refugee-children-rand-9780833092397-managing-the-crisis-in-turkey-lebanon-and-jordan-culbertson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780833092397.jpg?v=1767770780</image:loc>
      <image:title>Education of Syrian Refugee Children</image:title>
      <image:caption>Book cover of: Education of Syrian Refugee Children. By: Culbertson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schweiz-und-china-peter-lang-international-academic-publishers-9783261031051</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261031051.jpg?v=1767770784</image:loc>
      <image:title>Die Schweiz und China</image:title>
      <image:caption>Book cover of: Die Schweiz und China</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-migrant-children-and-china-s-future-taylor-francis-ltd-9780415630344-the-urban-left-behind</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415630344.jpg?v=1767770784</image:loc>
      <image:title>Education of Migrant Children and China&apos;s Future</image:title>
      <image:caption>Book cover of: Education of Migrant Children and China&apos;s Future</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-nations-harvard-university-press-9780674239005-a-comparison-in-historical-perspective-revised-edition-robert-ulich</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780674239005.jpg?v=1767770782</image:loc>
      <image:title>Education of Nations</image:title>
      <image:caption>Book cover of: Education of Nations. By: Robert Ulich</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-immigrant-children-taylor-francis-ltd-9781138080386-a-social-psychological-introduction-a-j-cropley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138080386.jpg?v=1767770783</image:loc>
      <image:title>Education of Immigrant Children</image:title>
      <image:caption>Book cover of: Education of Immigrant Children. By: A. J. Cropley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schwalben-von-berlin-blurb-9781364227333-steven-madsen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781364227333.jpg?v=1767770785</image:loc>
      <image:title>Die Schwalben von Berlin</image:title>
      <image:caption>Book cover of: Die Schwalben von Berlin. By: Steven Madsen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schweizerisch-franzoesischen-unterhandlungen-ueber-einen-handelsvertrag-und-der-abschluss-des-vertragswerkes-von-1864-peter-lang-international-academic-publishers-9783261001139-ein-beitrag-zur-geschichte-der-schweizerischen-wirtschaft-und-diplomatie-u</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261001139.jpg?v=1767770782</image:loc>
      <image:title>Die schweizerisch-franzoesischen Unterhandlungen ueber einen Handelsvertrag und der Abschluss des Vertragswerkes von 1864</image:title>
      <image:caption>Book cover of: Die schweizerisch-franzoesischen Unterhandlungen ueber einen Handelsvertrag und der Abschluss des Vertragswerkes von 1864. By: Urs Brand</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schweigepflicht-des-betriebsrats-peter-lang-ag-9783631362174</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631362174.jpg?v=1767770783</image:loc>
      <image:title>Die Schweigepflicht Des Betriebsrats</image:title>
      <image:caption>Book cover of: Die Schweigepflicht Des Betriebsrats</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-mrs-henry-adams-university-of-massachusetts-press-9780870239137</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780870239137.jpg?v=1767770782</image:loc>
      <image:title>Education of Mrs. Henry Adams</image:title>
      <image:caption>Book cover of: Education of Mrs. Henry Adams</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-laura-bridgman-harvard-university-press-9780674010055-first-deaf-and-blind-person-to-learn-language-ernest-freeberg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780674010055.jpg?v=1767770782</image:loc>
      <image:title>Education of Laura Bridgman</image:title>
      <image:caption>Book cover of: Education of Laura Bridgman. By: Ernest Freeberg</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-gifted-children-taylor-francis-ltd-9780713001563</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780713001563.jpg?v=1767770784</image:loc>
      <image:title>Education of Gifted Children</image:title>
      <image:caption>Book cover of: Education of Gifted Children</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schwaeche-der-tuerkischen-arbeiterbewegung-im-kontext-der-nationalen-bewegung-1908-1945-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631485248</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631485248.jpg?v=1767770784</image:loc>
      <image:title>Die Schwaeche der tuerkischen Arbeiterbewegung im Kontext der nationalen Bewegung (1908-1945)</image:title>
      <image:caption>Book cover of: Die Schwaeche der tuerkischen Arbeiterbewegung im Kontext der nationalen Bewegung (1908-1945)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-the-child-anthroposophic-press-inc-9780880104142-and-early-lectures-on-education</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780880104142.jpg?v=1767770783</image:loc>
      <image:title>Education of the Child</image:title>
      <image:caption>Book cover of: Education of the Child</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-eros-taylor-francis-ltd-9780415808514-a-history-of-education-and-the-problem-of-adolescent-sexuality-dennis-carlson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415808514.jpg?v=1767770783</image:loc>
      <image:title>Education of Eros</image:title>
      <image:caption>Book cover of: Education of Eros. By: Dennis Carlson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schwarzarbeit-als-problem-der-zeitallokation-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820476828</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820476828.jpg?v=1767770782</image:loc>
      <image:title>Die Schwarzarbeit als Problem der Zeitallokation</image:title>
      <image:caption>Book cover of: Die Schwarzarbeit als Problem der Zeitallokation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-immigrant-children-taylor-francis-ltd-9781138064676-a-social-psychological-introduction-a-j-cropley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138064676.jpg?v=1767770783</image:loc>
      <image:title>Education of Immigrant Children</image:title>
      <image:caption>Book cover of: Education of Immigrant Children. By: A. J. Cropley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schutzschrift-im-wettbewerbsrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820489149</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820489149.jpg?v=1767770784</image:loc>
      <image:title>Die Schutzschrift im Wettbewerbsrecht</image:title>
      <image:caption>Book cover of: Die Schutzschrift im Wettbewerbsrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-jane-addams-university-of-pennsylvania-press-9780812219524-victoria-bissell-brown</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780812219524.jpg?v=1767770783</image:loc>
      <image:title>Education of Jane Addams</image:title>
      <image:caption>Book cover of: Education of Jane Addams. By: Victoria Bissell Brown</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-eros-taylor-francis-ltd-9780415507516-a-history-of-education-and-the-problem-of-adolescent-sexuality-dennis-l-carlson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415507516.jpg?v=1767770782</image:loc>
      <image:title>Education of Eros</image:title>
      <image:caption>Book cover of: Education of Eros. By: Dennis L. Carlson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-david-martin-spck-publishing-9780281071180-the-making-of-an-unlikely-sociologist</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780281071180.jpg?v=1767770782</image:loc>
      <image:title>Education of David Martin</image:title>
      <image:caption>Book cover of: Education of David Martin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schulreform-maria-theresias-1747-1775-peter-lang-gmbh-9783820401325-das-oesterreichische-gymnasium-zwischen-standesschule-und-allgemeinbildender-lehranstalt-im-spannungsfeld-von-ordensschulwesen-theresianischem-reformabsolutismus-und-aufklaerungspaeda</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820401325.jpg?v=1767770785</image:loc>
      <image:title>Die Schulreform Maria Theresias 1747-1775</image:title>
      <image:caption>Book cover of: Die Schulreform Maria Theresias 1747-1775</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schutzfunktion-des-140-abs-2-stpo-zugunsten-des-beschuldigten-im-strafverfahren-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820451139-unter-besonderer-beruecksichtigung-der-neueren-rechtsprechung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820451139.jpg?v=1767770784</image:loc>
      <image:title>Die Schutzfunktion des  140 Abs. 2 StPO zugunsten des Beschuldigten im Strafverfahren</image:title>
      <image:caption>Book cover of: Die Schutzfunktion des  140 Abs. 2 StPO zugunsten des Beschuldigten im Strafverfahren</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-children-under-seven-taylor-francis-ltd-9780415672467-mary-sturt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415672467.jpg?v=1767770781</image:loc>
      <image:title>Education of Children Under Seven</image:title>
      <image:caption>Book cover of: Education of Children Under Seven. By: Mary Sturt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schweizerische-wechselkurspolitik-nach-dem-zweiten-weltkrieg-peter-lang-international-academic-publishers-9783261006844-1945-10-mai-1971-hermann-maurer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261006844.jpg?v=1767770783</image:loc>
      <image:title>Die schweizerische Wechselkurspolitik nach dem zweiten Weltkrieg</image:title>
      <image:caption>Book cover of: Die schweizerische Wechselkurspolitik nach dem zweiten Weltkrieg. By: Hermann Maurer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-children-and-young-people-in-state-care-taylor-francis-ltd-9781138934863-sonia-jackson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138934863.jpg?v=1767770784</image:loc>
      <image:title>Education of Children and Young People in State Care</image:title>
      <image:caption>Book cover of: Education of Children and Young People in State Care. By: Sonia Jackson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-children-taylor-francis-ltd-9781138912007-alfred-adler</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138912007.jpg?v=1767770782</image:loc>
      <image:title>Education of Children</image:title>
      <image:caption>Book cover of: Education of Children. By: Alfred Adler</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-john-dewey-columbia-university-press-9780231116763-a-biography-jay-martin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780231116763.jpg?v=1767770784</image:loc>
      <image:title>Education of John Dewey</image:title>
      <image:caption>Book cover of: Education of John Dewey. By: Jay Martin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schriftliche-form-germanistischer-arbeiten-springer-verlag-berlin-and-heidelberg-gmbh-co-kg-9783476999719-georg-bangen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783476999719.jpg?v=1767770784</image:loc>
      <image:title>Die schriftliche Form germanistischer Arbeiten</image:title>
      <image:caption>Book cover of: Die schriftliche Form germanistischer Arbeiten. By: Georg Bangen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schuldproblematik-im-spaetwerk-von-charles-dickens-peter-lang-international-academic-publishers-9783261026613</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261026613.jpg?v=1767770784</image:loc>
      <image:title>Die Schuldproblematik im Spaetwerk von Charles Dickens</image:title>
      <image:caption>Book cover of: Die Schuldproblematik im Spaetwerk von Charles Dickens</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-children-engaged-in-industry-in-england-1833-1876-taylor-francis-ltd-9780367138455-adam-henry-robson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367138455.jpg?v=1767770783</image:loc>
      <image:title>Education of Children Engaged in Industry in England 1833-1876</image:title>
      <image:caption>Book cover of: Education of Children Engaged in Industry in England 1833-1876. By: Adam Henry Robson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-children-engaged-in-industry-in-england-1833-1876-taylor-francis-ltd-9780367138509-adam-henry-robson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367138509.jpg?v=1767770785</image:loc>
      <image:title>Education of Children Engaged in Industry in England 1833-1876</image:title>
      <image:caption>Book cover of: Education of Children Engaged in Industry in England 1833-1876. By: Adam Henry Robson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schultheorie-georg-kerschensteiners-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631335963-eine-hermeneutische-rekonstruktion-ihrer-genese</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631335963.jpg?v=1767770784</image:loc>
      <image:title>Die Schultheorie Georg Kerschensteiners</image:title>
      <image:caption>Book cover of: Die Schultheorie Georg Kerschensteiners</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schriftliche-form-germanistischer-arbeiten-springer-verlag-berlin-and-heidelberg-gmbh-co-kg-9783476992512-georg-bagen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783476992512.jpg?v=1767770783</image:loc>
      <image:title>Die schriftliche Form germanistischer Arbeiten</image:title>
      <image:caption>Book cover of: Die schriftliche Form germanistischer Arbeiten. By: Georg Bagen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-eva-moskowitz-harpercollins-publishers-inc-9780062449795-eva-moskowitz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780062449795.jpg?v=1767770783</image:loc>
      <image:title>Education of Eva Moskowitz</image:title>
      <image:caption>Book cover of: Education of Eva Moskowitz. By: Eva Moskowitz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schuldfeststellung-bei-unternehmen-oder-unternehmensvereinigungen-im-rahmen-des-art-15-vo-17-zum-ewg-vertrag-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820497649-ein-beitrag-zum-wirtschaftsstrafrecht-der-europaeischen-gemeinschaft-a</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820497649.jpg?v=1767770783</image:loc>
      <image:title>Die Schuldfeststellung bei Unternehmen oder Unternehmensvereinigungen im Rahmen des Art. 15 VO 17 zum EWG-Vertrag</image:title>
      <image:caption>Book cover of: Die Schuldfeststellung bei Unternehmen oder Unternehmensvereinigungen im Rahmen des Art. 15 VO 17 zum EWG-Vertrag</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-a-value-investor-palgrave-macmillan-9781137278814-my-transformative-quest-for-wealth-wisdom-and-enlightenment-guy-spier</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781137278814.jpg?v=1767770784</image:loc>
      <image:title>Education of a Value Investor</image:title>
      <image:caption>Book cover of: Education of a Value Investor. By: Guy Spier</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schoene-musik-da-mu-ma-weinen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783899751345-vom-spektakel-der-inszenierungen-blaetter-aus-zerlinas-operntagebuch-2005-2008-muenchen-salzburg-stuttgart-wien-zuerich-und-die-provinz-zerlina-von-f</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783899751345.jpg?v=1767770785</image:loc>
      <image:title>Die Schoene Musik. Da Muß Ma Weinen</image:title>
      <image:caption>Book cover of: Die Schoene Musik. Da Muß Ma Weinen. By: Zerlina von Faninal</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schuldturmproblematik-im-zugriff-der-vorvertraglichen-pflichten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631459645</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631459645.jpg?v=1767770782</image:loc>
      <image:title>Die Schuldturmproblematik im Zugriff der vorvertraglichen Pflichten</image:title>
      <image:caption>Book cover of: Die Schuldturmproblematik im Zugriff der vorvertraglichen Pflichten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-booker-t-washington-columbia-university-press-9780231130486-american-democracy-and-the-idea-of-race-relations-michael-rudolph-west</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780231130486.jpg?v=1767770783</image:loc>
      <image:title>Education of Booker T. Washington</image:title>
      <image:caption>Book cover of: Education of Booker T. Washington. By: Michael Rudolph West</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-migrant-children-and-china-s-future-taylor-francis-inc-9780815375418-the-urban-left-behind-holly-h-ming</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815375418.jpg?v=1767770782</image:loc>
      <image:title>Education of Migrant Children and China&apos;s Future</image:title>
      <image:caption>Book cover of: Education of Migrant Children and China&apos;s Future. By: Holly H. Ming</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schiffsglaeubigerrechte-im-suedafrikanischen-nationalen-und-internationalen-privatrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820486001-eine-rechtsvergleichende-darstellung-unter-einbeziehung-des-englischen-und-deutschen-intern</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820486001.jpg?v=1767770785</image:loc>
      <image:title>Die Schiffsglaeubigerrechte im suedafrikanischen nationalen und internationalen Privatrecht</image:title>
      <image:caption>Book cover of: Die Schiffsglaeubigerrechte im suedafrikanischen nationalen und internationalen Privatrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-children-and-young-people-in-state-care-taylor-francis-ltd-9781138099128-sonia-jackson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138099128.jpg?v=1767770784</image:loc>
      <image:title>Education of Children and Young People in State Care</image:title>
      <image:caption>Book cover of: Education of Children and Young People in State Care. By: Sonia Jackson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schottische-renaissance-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631446980-literatur-und-nation-im-20-jahrhundert</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631446980.jpg?v=1767770783</image:loc>
      <image:title>Die Schottische Renaissance</image:title>
      <image:caption>Book cover of: Die Schottische Renaissance</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schlichtung-in-der-kollektiven-arbeitsverfassung-der-bundesrepublik-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631473948</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631473948.jpg?v=1767770787</image:loc>
      <image:title>Die Schlichtung in der kollektiven Arbeitsverfassung der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Schlichtung in der kollektiven Arbeitsverfassung der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schiedsstellen-fuer-arbeitsrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631452202</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631452202.jpg?v=1767770788</image:loc>
      <image:title>Die Schiedsstellen fuer Arbeitsrecht</image:title>
      <image:caption>Book cover of: Die Schiedsstellen fuer Arbeitsrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-man-v1-taylor-francis-ltd-9780415220385-f-froebel</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415220385.jpg?v=1767770783</image:loc>
      <image:title>Education Of Man V1</image:title>
      <image:caption>Book cover of: Education Of Man V1. By: F. Froebel</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-a-christian-woman-the-university-of-chicago-press-9780226858159-a-sixteenth-century-manual-juan-luis-vives</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226858159.jpg?v=1767770786</image:loc>
      <image:title>Education of a Christian Woman</image:title>
      <image:caption>Book cover of: Education of a Christian Woman. By: Juan Luis Vives</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schuldtilgung-nach-den-366-367-bgb-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631462195</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631462195.jpg?v=1767770782</image:loc>
      <image:title>Die Schuldtilgung nach den  366, 367 BGB</image:title>
      <image:caption>Book cover of: Die Schuldtilgung nach den  366, 367 BGB</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schaedigung-des-gesellschafter-geschaeftsfuehrers-und-seiner-kapitalgesellschaft-durch-auenstehende-dritte-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631420898-eine-rechtsvergleichende-studie-zum-gesellschafts-delikts-und-schadensre</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631420898.jpg?v=1767770784</image:loc>
      <image:title>Die Schaedigung des Gesellschafter-Geschaeftsfuehrers und seiner Kapitalgesellschaft durch auenstehende Dritte</image:title>
      <image:caption>Book cover of: Die Schaedigung des Gesellschafter-Geschaeftsfuehrers und seiner Kapitalgesellschaft durch auenstehende Dritte</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-booker-t-washington-columbia-university-press-9780231130493-american-democracy-and-the-idea-of-race-relations-michael-rudolph-west</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780231130493.jpg?v=1767770783</image:loc>
      <image:title>Education of Booker T. Washington</image:title>
      <image:caption>Book cover of: Education of Booker T. Washington. By: Michael Rudolph West</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schulklasse-herbert-cie-lang-ag-buchhandlung-antiquariat-9783261044464-eine-historisch-systematische-untersuchung-susanna-jenzer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261044464.jpg?v=1767770789</image:loc>
      <image:title>Die Schulklasse</image:title>
      <image:caption>Book cover of: Die Schulklasse. By: Susanna Jenzer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schriftliche-form-germanistischer-arbeiten-springer-verlag-berlin-and-heidelberg-gmbh-co-kg-9783476997586-georg-bangen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783476997586.jpg?v=1767770785</image:loc>
      <image:title>Die schriftliche Form germanistischer Arbeiten</image:title>
      <image:caption>Book cover of: Die schriftliche Form germanistischer Arbeiten. By: Georg Bangen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-children-under-seven-taylor-francis-ltd-9780415753388-mary-sturt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415753388.jpg?v=1767770782</image:loc>
      <image:title>Education of Children Under Seven</image:title>
      <image:caption>Book cover of: Education of Children Under Seven. By: Mary Sturt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-a-christian-society-taylor-francis-ltd-9780754600015-humanism-and-the-reformation-in-britain-and-the-netherlands</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780754600015.jpg?v=1767770784</image:loc>
      <image:title>Education of a Christian Society</image:title>
      <image:caption>Book cover of: Education of a Christian Society</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schenkungsteuerliche-behandlung-von-zuwendungen-zwischen-ehegatten-peter-lang-ag-9783631532638-torsten-engers</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631532638.jpg?v=1767770786</image:loc>
      <image:title>Die Schenkungsteuerliche Behandlung Von Zuwendungen Zwischen Ehegatten</image:title>
      <image:caption>Book cover of: Die Schenkungsteuerliche Behandlung Von Zuwendungen Zwischen Ehegatten. By: Torsten Engers</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-networks-taylor-francis-ltd-9780415899833-power-wealth-cyberspace-and-the-digital-mind-joel-h-spring</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415899833.jpg?v=1767770785</image:loc>
      <image:title>Education Networks</image:title>
      <image:caption>Book cover of: Education Networks. By: Joel H. Spring</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-black-males-in-a-post-racial-world-taylor-francis-ltd-9780415673020-anthony-l-brown</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415673020.jpg?v=1767770785</image:loc>
      <image:title>Education of Black Males in a &apos;Post-Racial&apos; World</image:title>
      <image:caption>Book cover of: Education of Black Males in a &apos;Post-Racial&apos; World. By: Anthony L. Brown</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-a-wandering-man-random-house-usa-inc-9780553286526-a-memoir</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780553286526.jpg?v=1767770786</image:loc>
      <image:title>Education of a Wandering Man</image:title>
      <image:caption>Book cover of: Education of a Wandering Man</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-a-countryman-taylor-francis-ltd-9780415864015</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415864015.jpg?v=1767770783</image:loc>
      <image:title>Education of a Countryman</image:title>
      <image:caption>Book cover of: Education of a Countryman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-networks-taylor-francis-ltd-9780415899840-power-wealth-cyberspace-and-the-digital-mind-joel-h-spring</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415899840.jpg?v=1767770786</image:loc>
      <image:title>Education Networks</image:title>
      <image:caption>Book cover of: Education Networks. By: Joel H. Spring</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-matters-taylor-francis-ltd-9781138117266-60-years-of-the-british-journal-of-educational-studies-james-arthur</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138117266.jpg?v=1767770788</image:loc>
      <image:title>Education Matters</image:title>
      <image:caption>Book cover of: Education Matters. By: James Arthur</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schaffhauser-glasmalerei-des-16-bis-18-jahrhunderts-peter-lang-ag-9783034304962-corpus-vitrearum-schweiz-reihe-neuzeit-bd-5-herausgegeben-von-vitrocentre-romont-rolf-hasler</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783034304962.jpg?v=1767770788</image:loc>
      <image:title>Die Schaffhauser Glasmalerei Des 16. Bis 18. Jahrhunderts</image:title>
      <image:caption>Book cover of: Die Schaffhauser Glasmalerei Des 16. Bis 18. Jahrhunderts. By: Rolf Hasler</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-management-and-management-science-taylor-francis-ltd-9781138026636-proceedings-of-the-international-conference-on-education-management-and-management-science-icemms-2014-august-7-8-2014-tianjin-china-dawei-zheng</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138026636.jpg?v=1767770785</image:loc>
      <image:title>Education Management and Management Science</image:title>
      <image:caption>Book cover of: Education Management and Management Science. By: Dawei Zheng</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schadenersatzhaftung-des-verkaeufers-nach-dem-wiener-uebereinkommen-ueber-internationale-warenkaufvertraege-vom-11-april-1980-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906750156</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906750156.jpg?v=1767770786</image:loc>
      <image:title>Die Schadenersatzhaftung des Verkaeufers nach dem Wiener Uebereinkommen ueber internationale Warenkaufvertraege-vom 11. April 1980</image:title>
      <image:caption>Book cover of: Die Schadenersatzhaftung des Verkaeufers nach dem Wiener Uebereinkommen ueber internationale Warenkaufvertraege-vom 11. April 1980</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-scheinbare-rechtsgutsverletzung-bei-den-auf-enteignung-gerichteten-eigentumsdelikten-diebstahl-unterschlagung-raub-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820493351</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820493351.jpg?v=1767770785</image:loc>
      <image:title>Die scheinbare Rechtsgutsverletzung bei den auf Enteignung gerichteten Eigentumsdelikten (Diebstahl, Unterschlagung, Raub)</image:title>
      <image:caption>Book cover of: Die scheinbare Rechtsgutsverletzung bei den auf Enteignung gerichteten Eigentumsdelikten (Diebstahl, Unterschlagung, Raub)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schadensersatzrechtliche-problematik-des-unerwuenschten-kindes-im-deutschen-zivilrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631362846-stefan-ostheide</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631362846.jpg?v=1767770784</image:loc>
      <image:title>Die schadensersatzrechtliche Problematik des unerwuenschten Kindes im deutschen Zivilrecht</image:title>
      <image:caption>Book cover of: Die schadensersatzrechtliche Problematik des unerwuenschten Kindes im deutschen Zivilrecht. By: Stefan Ostheide</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schrecklichen-und-wundervollen-grunde-lange-strecken-zu-laufen-wiley-vch-verlag-gmbh-9783527508464-the-the-oatmeal</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783527508464.jpg?v=1767770789</image:loc>
      <image:title>Die schrecklichen und wundervollen Grunde, lange Strecken zu laufen</image:title>
      <image:caption>Book cover of: Die schrecklichen und wundervollen Grunde, lange Strecken zu laufen. By: The The Oatmeal</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-children-taylor-francis-ltd-9781138919327-alfred-adler</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138919327.jpg?v=1767770784</image:loc>
      <image:title>Education of Children</image:title>
      <image:caption>Book cover of: Education of Children. By: Alfred Adler</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schule-als-ort-kuenstlicher-intelligenz-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631407493-bruchstuecke-zu-einem-steckbrief-der-regelschule</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631407493.jpg?v=1767770788</image:loc>
      <image:title>Die Schule als Ort «kuenstlicher Intelligenz»</image:title>
      <image:caption>Book cover of: Die Schule als Ort «kuenstlicher Intelligenz»</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-inequality-john-wiley-and-sons-ltd-9781119390732-opportunity-and-mobility-norman-eng</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781119390732.jpg?v=1767770785</image:loc>
      <image:title>Education Inequality</image:title>
      <image:caption>Book cover of: Education Inequality. By: Norman Eng</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-satzstrukturen-im-mordwinischen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631456996</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631456996.jpg?v=1767770787</image:loc>
      <image:title>Die Satzstrukturen im Mordwinischen</image:title>
      <image:caption>Book cover of: Die Satzstrukturen im Mordwinischen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-myths-bloomsbury-publishing-plc-9780742549784-what-special-interest-groups-want-you-to-believe-about-our-schools-and-why-it-isn-t-so-jay-p-greene</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780742549784.jpg?v=1767770787</image:loc>
      <image:title>Education Myths</image:title>
      <image:caption>Book cover of: Education Myths. By: Jay P. Greene</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schulgliederung-als-paedagogischer-einflussfaktor-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820479966-eine-empirische-studie-an-der-schottischen-comprehensive-school</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820479966.jpg?v=1767770787</image:loc>
      <image:title>Die Schulgliederung als paedagogischer Einflussfaktor</image:title>
      <image:caption>Book cover of: Die Schulgliederung als paedagogischer Einflussfaktor</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-a-countryman-taylor-francis-ltd-9780415177603-h-m-burton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415177603.jpg?v=1767770786</image:loc>
      <image:title>Education of a Countryman</image:title>
      <image:caption>Book cover of: Education of a Countryman. By: H.m. Burton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sachverhaltsermittlung-im-arbeitsgerichtlichen-beschluverfahren-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631441756</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631441756.jpg?v=1767770785</image:loc>
      <image:title>Die Sachverhaltsermittlung im arbeitsgerichtlichen Beschluverfahren</image:title>
      <image:caption>Book cover of: Die Sachverhaltsermittlung im arbeitsgerichtlichen Beschluverfahren</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-industry-taylor-francis-ltd-9780415750486-w-kenneth-richmond</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415750486.jpg?v=1767770784</image:loc>
      <image:title>Education Industry</image:title>
      <image:caption>Book cover of: Education Industry. By: W. Kenneth Richmond</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-satire-im-nigerianischen-roman-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820483260-die-rolle-der-satire-in-den-romanwerken-vier-nigerianischer-schriftsteller-t-m-aluko-chinua-achebe-nkem-nwankwo-und-wole-soyinka</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820483260.jpg?v=1767770785</image:loc>
      <image:title>Die Satire im nigerianischen Roman</image:title>
      <image:caption>Book cover of: Die Satire im nigerianischen Roman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-law-oxford-university-press-9780406924070-text-cases-and-materials-anne-ruff</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780406924070.jpg?v=1767770786</image:loc>
      <image:title>Education Law</image:title>
      <image:caption>Book cover of: Education Law. By: Anne Ruff</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schadensersatzpflicht-nach-den-haager-einheitlichen-kaufgesetzen-und-dem-wiener-un-kaufrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631420294</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631420294.jpg?v=1767770785</image:loc>
      <image:title>Die Schadensersatzpflicht nach den Haager Einheitlichen Kaufgesetzen  und dem Wiener UN-Kaufrecht</image:title>
      <image:caption>Book cover of: Die Schadensersatzpflicht nach den Haager Einheitlichen Kaufgesetzen  und dem Wiener UN-Kaufrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-into-the-21st-century-taylor-francis-ltd-9780750706575-dangerous-terrain-for-women</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750706575.jpg?v=1767770784</image:loc>
      <image:title>Education into the 21st Century</image:title>
      <image:caption>Book cover of: Education into the 21st Century</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-matters-taylor-francis-ltd-9780415505529-60-years-of-the-british-journal-of-educational-studies-arthur-james</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415505529.jpg?v=1767770787</image:loc>
      <image:title>Education Matters</image:title>
      <image:caption>Book cover of: Education Matters. By: Arthur, James</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-is-not-an-app-taylor-francis-ltd-9781138910409-the-future-of-university-teaching-in-the-internet-age-jonathan-rees</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138910409.jpg?v=1767770785</image:loc>
      <image:title>Education Is Not an App</image:title>
      <image:caption>Book cover of: Education Is Not an App. By: Jonathan Rees</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-of-a-speculator-john-wiley-sons-inc-9780471249481-victor-niederhoffer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780471249481.jpg?v=1767770785</image:loc>
      <image:title>Education of a Speculator</image:title>
      <image:caption>Book cover of: Education of a Speculator. By: Victor Niederhoffer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schekhina-in-rabbinischen-gleichnissen-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906751832</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906751832.jpg?v=1767770793</image:loc>
      <image:title>Die Schekhina in rabbinischen Gleichnissen</image:title>
      <image:caption>Book cover of: Die Schekhina in rabbinischen Gleichnissen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-world-history-taylor-francis-ltd-9780415318143-mark-s-johnson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415318143.jpg?v=1767770786</image:loc>
      <image:title>Education in World History</image:title>
      <image:caption>Book cover of: Education in World History. By: Mark S Johnson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-saeugetiere-und-voegel-aus-der-fruehgeschichtlichen-wurt-elisenhof-die-fischreste-aus-der-fruehgeschichtlichen-wurt-elisenhof-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631462157-die-fischreste-aus-der-fruehgeschichtlichen-wurt-elis</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631462157.jpg?v=1767770788</image:loc>
      <image:title>Die Saeugetiere und Voegel aus der Fruehgeschichtlichen Wurt Elisenhof- Die Fischreste aus der Fruehgeschichtlichen Wurt Elisenhof</image:title>
      <image:caption>Book cover of: Die Saeugetiere und Voegel aus der Fruehgeschichtlichen Wurt Elisenhof- Die Fischreste aus der Fruehgeschichtlichen Wurt Elisenhof</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-for-socialism-taylor-francis-ltd-9781138956377-historical-current-and-future-perspectives-tom-g-griffiths</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138956377.jpg?v=1767770786</image:loc>
      <image:title>Education in/for Socialism</image:title>
      <image:caption>Book cover of: Education in/for Socialism. By: Tom G. Griffiths</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-satirischen-komoedien-vl-i-lukins-1737-1794-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876900803-ein-beitrag-zur-typologie-der-russischen-komoedie-der-aufklaerungszeit-hannelore-guski</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876900803.jpg?v=1767770787</image:loc>
      <image:title>Die satirischen Komoedien VL. I. Lukins (1737-1794)</image:title>
      <image:caption>Book cover of: Die satirischen Komoedien VL. I. Lukins (1737-1794). By: Hannelore Guski</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-world-history-taylor-francis-ltd-9780415318136-mark-s-johnson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415318136.jpg?v=1767770787</image:loc>
      <image:title>Education in World History</image:title>
      <image:caption>Book cover of: Education in World History. By: Mark S Johnson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sachmaengelhaftung-des-verkaeufers-beim-kauf-beweglicher-sachen-nach-deutschem-und-tuerkischem-recht-mit-einem-blick-auf-das-internationale-privat-und-zivilverfahrensrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631431566</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631431566.jpg?v=1767770785</image:loc>
      <image:title>Die Sachmaengelhaftung des Verkaeufers beim Kauf beweglicher Sachen nach deutschem und tuerkischem Recht mit einem Blick auf das Internationale Privat- und Zivilverfahrensrecht</image:title>
      <image:caption>Book cover of: Die Sachmaengelhaftung des Verkaeufers beim Kauf beweglicher Sachen nach deutschem und tuerkischem Recht mit einem Blick auf das Internationale Privat- und Zivilverfahrensrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sachgruendung-der-gmbh-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631355732-daniela-hasche</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631355732.jpg?v=1767770787</image:loc>
      <image:title>Die Sachgruendung der GmbH</image:title>
      <image:caption>Book cover of: Die Sachgruendung der GmbH. By: Daniela Hasche</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-is-not-an-app-taylor-francis-ltd-9781138910416-the-future-of-university-teaching-in-the-internet-age-jonathan-rees</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138910416.jpg?v=1767770786</image:loc>
      <image:title>Education Is Not an App</image:title>
      <image:caption>Book cover of: Education Is Not an App. By: Jonathan Rees</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sanktionierung-von-obliegenheitsverletzungen-nach-dem-alles-oder-nichts-prinzip-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783899756456-ein-rueck-und-ausblick-von-den-anfaengen-bis-zur-reform-des-vvg-zum-01-08-2008-unter-beruecksichtig</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783899756456.jpg?v=1767770788</image:loc>
      <image:title>Die Sanktionierung Von Obliegenheitsverletzungen Nach Dem Alles-Oder-Nichts-Prinzip</image:title>
      <image:caption>Book cover of: Die Sanktionierung Von Obliegenheitsverletzungen Nach Dem Alles-Oder-Nichts-Prinzip. By: René Steinbeck</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-transition-taylor-francis-ltd-9780415510431-an-interim-report-h-c-dent</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415510431.jpg?v=1767770789</image:loc>
      <image:title>Education in Transition</image:title>
      <image:caption>Book cover of: Education in Transition. By: H. C. Dent</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sachverhaltsarbeit-im-deutschen-italienischen-franzoesischen-und-us-amerikanischen-recht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631316740-vereinheitlichungsmoeglichkeiten-im-hinblick-auf-art-7-cisg-maximilian-schunke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631316740.jpg?v=1767770788</image:loc>
      <image:title>Die Sachverhaltsarbeit im deutschen, italienischen, franzoesischen und US-amerikanischen Recht</image:title>
      <image:caption>Book cover of: Die Sachverhaltsarbeit im deutschen, italienischen, franzoesischen und US-amerikanischen Recht. By: Maximilian Schunke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-tokugawa-japan-taylor-francis-ltd-9780415587594-ronald-dore</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415587594.jpg?v=1767770789</image:loc>
      <image:title>Education in Tokugawa Japan</image:title>
      <image:caption>Book cover of: Education in Tokugawa Japan. By: Ronald Dore</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-schadensersatzrechtliche-reduktionsklausel-255-a-bgb-referentenentwurf-1967-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820480047-eine-vergleichende-untersuchung-mit-dem-schweizer-recht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820480047.jpg?v=1767770788</image:loc>
      <image:title>Die schadensersatzrechtliche Reduktionsklausel  255 a BGB Referentenentwurf 1967</image:title>
      <image:caption>Book cover of: Die schadensersatzrechtliche Reduktionsklausel  255 a BGB Referentenentwurf 1967</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sachliche-rechtfertigung-des-verschmelzungsbeschlusses-boersennotierter-aktiengesellschaften-peter-lang-ag-9783631566749-ein-deutsch-polnischer-rechtsvergleich-zu-den-kali-und-salz-grundsaetzen-darius-oliver-schindler</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631566749.jpg?v=1767770787</image:loc>
      <image:title>Die Sachliche Rechtfertigung Des Verschmelzungsbeschlusses Boersennotierter Aktiengesellschaften</image:title>
      <image:caption>Book cover of: Die Sachliche Rechtfertigung Des Verschmelzungsbeschlusses Boersennotierter Aktiengesellschaften. By: Darius Oliver Schindler</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sachgruendung-nach-der-gmbh-novelle-1980-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820453027</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820453027.jpg?v=1767770786</image:loc>
      <image:title>Die Sachgruendung nach der GmbH-Novelle 1980</image:title>
      <image:caption>Book cover of: Die Sachgruendung nach der GmbH-Novelle 1980</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-secondary-modern-school-taylor-francis-ltd-9780415750806-j-jb-dempster</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415750806.jpg?v=1767770786</image:loc>
      <image:title>Education in the Secondary Modern School</image:title>
      <image:caption>Book cover of: Education in the Secondary Modern School. By: J. Jb Dempster</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-transition-taylor-francis-ltd-9780415177597-an-interim-report-h-c-dent</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415177597.jpg?v=1767770786</image:loc>
      <image:title>Education in Transition</image:title>
      <image:caption>Book cover of: Education in Transition. By: H. C. Dent</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-russischen-und-ukrainischen-volkserzaehlungen-von-marko-vovcok-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631742532-katerina-horbatsch</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631742532.jpg?v=1767770788</image:loc>
      <image:title>Die russischen und ukrainischen Volkserzaehlungen von Marko Vovcok</image:title>
      <image:caption>Book cover of: Die russischen und ukrainischen Volkserzaehlungen von Marko Vovcok. By: Katerina Horbatsch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-third-world-taylor-francis-ltd-9780415594608-keith-watson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415594608.jpg?v=1767770789</image:loc>
      <image:title>Education in the Third World</image:title>
      <image:caption>Book cover of: Education in the Third World. By: Keith Watson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-russischen-proadverbien-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820454901</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820454901.jpg?v=1767770789</image:loc>
      <image:title>Die russischen Proadverbien</image:title>
      <image:caption>Book cover of: Die russischen Proadverbien</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-second-world-war-taylor-francis-ltd-9780415759786-a-study-in-policy-and-administration-peter-gosden</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415759786.jpg?v=1767770786</image:loc>
      <image:title>Education in the Second World War</image:title>
      <image:caption>Book cover of: Education in the Second World War. By: Peter Gosden</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-saarfrage-und-die-alliierten-1942-1948-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631455678</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631455678.jpg?v=1767770786</image:loc>
      <image:title>Die Saarfrage und die Alliierten 1942-1948</image:title>
      <image:caption>Book cover of: Die Saarfrage und die Alliierten 1942-1948</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-post-war-years-taylor-francis-ltd-9781138006461-a-social-history-roy-lowe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138006461.jpg?v=1767770786</image:loc>
      <image:title>Education in the Post-War Years</image:title>
      <image:caption>Book cover of: Education in the Post-War Years. By: Roy Lowe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sanierung-von-altlasten-rechtliche-instrumente-und-vollzug-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631465516-eine-rechtsvergleichende-untersuchung-des-rechts-der-vereinigten-staaten-von-amerika-und-der-bundesrepublik-deutschland</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631465516.jpg?v=1767770787</image:loc>
      <image:title>Die Sanierung von Altlasten - Rechtliche Instrumente und Vollzug</image:title>
      <image:caption>Book cover of: Die Sanierung von Altlasten - Rechtliche Instrumente und Vollzug</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sachgesamtheit-als-gegenstand-des-klassischen-roemischen-rechts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631457016-vornehmlich-unter-dem-blickwinkel-von-veraenderungen-in-ihrer-zusammensetzung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631457016.jpg?v=1767770790</image:loc>
      <image:title>Die Sachgesamtheit als Gegenstand des klassischen roemischen Rechts</image:title>
      <image:caption>Book cover of: Die Sachgesamtheit als Gegenstand des klassischen roemischen Rechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-third-world-taylor-francis-ltd-9780415847308-keith-watson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415847308.jpg?v=1767770786</image:loc>
      <image:title>Education in the Third World</image:title>
      <image:caption>Book cover of: Education in the Third World. By: Keith Watson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-two-germani-taylor-francis-ltd-9780367021412-arthur-hearnden</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367021412.jpg?v=1767770789</image:loc>
      <image:title>Education In Two Germani</image:title>
      <image:caption>Book cover of: Education In Two Germani. By: Arthur Hearnden</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-industry-taylor-francis-ltd-9780415677073-w-kenneth-richmond</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415677073.jpg?v=1767770787</image:loc>
      <image:title>Education Industry</image:title>
      <image:caption>Book cover of: Education Industry. By: W. Kenneth Richmond</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-new-china-taylor-francis-ltd-9780754619147-shaping-ideas-at-work-yvonne-turner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780754619147.jpg?v=1767770787</image:loc>
      <image:title>Education in the New China</image:title>
      <image:caption>Book cover of: Education in the New China. By: Yvonne Turner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-soviet-union-taylor-francis-ltd-9780415668408-policies-and-institutions-since-stalin-mervyn-matthews</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415668408.jpg?v=1767770789</image:loc>
      <image:title>Education in the Soviet Union</image:title>
      <image:caption>Book cover of: Education in the Soviet Union. By: Mervyn Matthews</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-secondary-modern-school-taylor-francis-ltd-9780415689106-j-jb-dempster</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415689106.jpg?v=1767770789</image:loc>
      <image:title>Education in the Secondary Modern School</image:title>
      <image:caption>Book cover of: Education in the Secondary Modern School. By: J JB Dempster</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sage-von-heinrich-dem-loewen-bei-den-slaven-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876900957</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876900957.jpg?v=1767770790</image:loc>
      <image:title>Die Sage von Heinrich dem Loewen bei den Slaven</image:title>
      <image:caption>Book cover of: Die Sage von Heinrich dem Loewen bei den Slaven</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-soviet-union-taylor-francis-ltd-9781138008403-policies-and-institutions-since-stalin-mervyn-matthews</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138008403.jpg?v=1767770789</image:loc>
      <image:title>Education in the Soviet Union</image:title>
      <image:caption>Book cover of: Education in the Soviet Union. By: Mervyn Matthews</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-united-kingdom-taylor-francis-ltd-9781138163089-structures-and-organisation</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138163089.jpg?v=1767770787</image:loc>
      <image:title>Education in the United Kingdom</image:title>
      <image:caption>Book cover of: Education in the United Kingdom</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-times-of-environmental-crises-taylor-francis-ltd-9781138944350-teaching-children-to-be-agents-of-change-ken-winograd</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138944350.jpg?v=1767770786</image:loc>
      <image:title>Education in Times of Environmental Crises</image:title>
      <image:caption>Book cover of: Education in Times of Environmental Crises. By: Ken Winograd</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-moral-domain-cambridge-university-press-9780521655491-larry-p-nucci</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521655491.jpg?v=1767770787</image:loc>
      <image:title>Education in the Moral Domain</image:title>
      <image:caption>Book cover of: Education in the Moral Domain. By: Larry P. Nucci</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-black-diaspora-taylor-francis-ltd-9780415890342-perspectives-challenges-and-prospects-kassie-freeman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415890342.jpg?v=1767770788</image:loc>
      <image:title>Education in the Black Diaspora</image:title>
      <image:caption>Book cover of: Education in the Black Diaspora. By: Kassie Freeman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-second-world-war-taylor-francis-ltd-9780415432207-a-study-in-policy-and-administration-peter-godsen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415432207.jpg?v=1767770789</image:loc>
      <image:title>Education in the Second World War</image:title>
      <image:caption>Book cover of: Education in the Second World War. By: Peter Godsen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-comanche-nation-taylor-francis-ltd-9781138802490-relationships-responsibility-redistribution-and-reciprocity</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138802490.jpg?v=1767770788</image:loc>
      <image:title>Education in the Comanche Nation</image:title>
      <image:caption>Book cover of: Education in the Comanche Nation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-sacheinlagefaehigkeit-im-rahmen-der-qualifizierten-gruendung-von-aktiengesellschaften-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631417201</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631417201.jpg?v=1767770786</image:loc>
      <image:title>Die Sacheinlagefaehigkeit im Rahmen der qualifizierten Gruendung von Aktiengesellschaften</image:title>
      <image:caption>Book cover of: Die Sacheinlagefaehigkeit im Rahmen der qualifizierten Gruendung von Aktiengesellschaften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-into-the-21st-century-taylor-francis-ltd-9780750706568-dangerous-terrain-for-women</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750706568.jpg?v=1767770787</image:loc>
      <image:title>Education into the 21st Century</image:title>
      <image:caption>Book cover of: Education into the 21st Century</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-post-war-years-taylor-francis-ltd-9780415689229-a-social-history-roy-lowe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415689229.jpg?v=1767770788</image:loc>
      <image:title>Education in the Post-War Years</image:title>
      <image:caption>Book cover of: Education in the Post-War Years. By: Roy Lowe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-times-of-environmental-crises-taylor-francis-ltd-9781138944367-teaching-children-to-be-agents-of-change-ken-winograd</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138944367.jpg?v=1767770789</image:loc>
      <image:title>Education in Times of Environmental Crises</image:title>
      <image:caption>Book cover of: Education in Times of Environmental Crises. By: Ken Winograd</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-moral-domain-cambridge-university-press-9780521652322-larry-nucci</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521652322.jpg?v=1767770788</image:loc>
      <image:title>Education in the Moral Domain</image:title>
      <image:caption>Book cover of: Education in the Moral Domain. By: Larry Nucci</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-small-states-taylor-francis-ltd-9780415848435-global-imperatives-regional-initiatives-and-local-dilemmas-peter-mayo</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415848435.jpg?v=1767770789</image:loc>
      <image:title>Education in Small States</image:title>
      <image:caption>Book cover of: Education in Small States. By: Peter Mayo</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-small-states-taylor-francis-ltd-9780415560399-global-imperatives-regional-initiatives-and-local-dilemmas-peter-mayo</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415560399.jpg?v=1767770788</image:loc>
      <image:title>Education in Small States</image:title>
      <image:caption>Book cover of: Education in Small States. By: Peter Mayo</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-russischen-partikeln-als-pragmalexeme-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876903149</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876903149.jpg?v=1767770790</image:loc>
      <image:title>Die russischen Partikeln als Pragmalexeme</image:title>
      <image:caption>Book cover of: Die russischen Partikeln als Pragmalexeme</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-russischen-nomina-abstracta-des-19-jahrhunderts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820416688-teil-2-der-lexikalische-bestand-der-zweiten-haelfte-des-19-jahrhunderts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820416688.jpg?v=1767770789</image:loc>
      <image:title>Die russischen Nomina abstracta des 19. Jahrhunderts</image:title>
      <image:caption>Book cover of: Die russischen Nomina abstracta des 19. Jahrhunderts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-russischen-nomina-abstracta-des-19-jahrhunderts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820411157-teil-1-der-lexikalische-bestand-der-ersten-haelfte-des-19-jahrhunderts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820411157.jpg?v=1767770790</image:loc>
      <image:title>Die russischen Nomina abstracta des 19. Jahrhunderts</image:title>
      <image:caption>Book cover of: Die russischen Nomina abstracta des 19. Jahrhunderts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-russische-literatur-1945-1976-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876901541-mit-einem-verzeichnis-der-uebersetzungen-ins-deutsche-1945-1979</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876901541.jpg?v=1767770790</image:loc>
      <image:title>Die russische Literatur 1945-1976</image:title>
      <image:caption>Book cover of: Die russische Literatur 1945-1976</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-russische-sprache-im-vergleich-zur-polnischen-und-deutschen-sprache-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631405406</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631405406.jpg?v=1767770792</image:loc>
      <image:title>Die russische Sprache im Vergleich zur polnischen und deutschen Sprache</image:title>
      <image:caption>Book cover of: Die russische Sprache im Vergleich zur polnischen und deutschen Sprache</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-russischen-nomina-abstracta-des-18-und-beginnenden-19-jahrhunderts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820480160-ein-beitrag-zur-wortbildung-und-wortforschung-teil-1-lexikalischer-bestand</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820480160.jpg?v=1767770790</image:loc>
      <image:title>Die russischen Nomina abstracta des 18. und beginnenden 19. Jahrhunderts</image:title>
      <image:caption>Book cover of: Die russischen Nomina abstracta des 18. und beginnenden 19. Jahrhunderts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-prison-taylor-francis-ltd-9781138246966-studying-through-distance-learning-emma-hughes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138246966.jpg?v=1767770788</image:loc>
      <image:title>Education in Prison</image:title>
      <image:caption>Book cover of: Education in Prison. By: Emma Hughes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-new-millennium-university-press-of-america-9780761826484-not-like-your-grandmother-s-schoolhouse-michael-f-shaughnessy</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761826484.jpg?v=1767770788</image:loc>
      <image:title>Education in the New Millennium</image:title>
      <image:caption>Book cover of: Education in the New Millennium. By: Michael F. Shaughnessy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rueckkehr-des-subjekts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783899752793-neues-autorenkino-in-der-romania-kirsten-von-hagen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783899752793.jpg?v=1767770790</image:loc>
      <image:title>Die Rueckkehr Des Subjekts</image:title>
      <image:caption>Book cover of: Die Rueckkehr Des Subjekts. By: Kirsten von Hagen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-russisch-afghanischen-beziehungen-von-der-ersten-russischen-gesandtschaft-1878-79-nach-afghanistan-bis-zum-sowjetischen-einmarsch-in-afghanistan-am-27-12-1979-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820491944</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820491944.jpg?v=1767770792</image:loc>
      <image:title>Die russisch-afghanischen Beziehungen von der ersten russischen Gesandtschaft 1878/79 nach Afghanistan bis zum sowjetischen Einmarsch in Afghanistan am 27.12.1979</image:title>
      <image:caption>Book cover of: Die russisch-afghanischen Beziehungen von der ersten russischen Gesandtschaft 1878/79 nach Afghanistan bis zum sowjetischen Einmarsch in Afghanistan am 27.12.1979</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rueckwirkende-taetigkeitsverguetung-des-beherrschenden-gesellschafter-geschaeftsfuehrers-im-zivil-gmbh-und-steuerrecht-peter-lang-ag-9783631342596</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631342596.jpg?v=1767770791</image:loc>
      <image:title>Die Rueckwirkende Taetigkeitsverguetung Des Beherrschenden Gesellschafter-Geschaeftsfuehrers Im Zivil-, Gmbh- Und Steuerrecht</image:title>
      <image:caption>Book cover of: Die Rueckwirkende Taetigkeitsverguetung Des Beherrschenden Gesellschafter-Geschaeftsfuehrers Im Zivil-, Gmbh- Und Steuerrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rundfunkkompetenz-des-bundes-als-beispiel-bundesstaatlicher-kulturkompetenz-in-der-bundesrepublik-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631342398-eine-untersuchung-unter-besonderer-beruecksichtigung-natuerlicher-kom</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631342398.jpg?v=1767770790</image:loc>
      <image:title>Die Rundfunkkompetenz des Bundes als Beispiel bundesstaatlicher Kulturkompetenz in der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Rundfunkkompetenz des Bundes als Beispiel bundesstaatlicher Kulturkompetenz in der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-rural-america-taylor-francis-ltd-9780367017552-a-reassessment-of-conventional-wisdom-jonathan-p-sher</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367017552.jpg?v=1767770789</image:loc>
      <image:title>Education In Rural America</image:title>
      <image:caption>Book cover of: Education In Rural America. By: Jonathan P. Sher</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-development-of-tanzania-1919-90-james-currey-9780852557044-lene-buchert</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780852557044.jpg?v=1767770788</image:loc>
      <image:title>Education in the Development of Tanzania, 1919-90</image:title>
      <image:caption>Book cover of: Education in the Development of Tanzania, 1919-90. By: Lene Buchert</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rueckforderung-von-ehegattenschenkungen-im-falle-der-scheidung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820477894</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820477894.jpg?v=1767770789</image:loc>
      <image:title>Die Rueckforderung von Ehegattenschenkungen im Falle der Scheidung</image:title>
      <image:caption>Book cover of: Die Rueckforderung von Ehegattenschenkungen im Falle der Scheidung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rundschau-debatte-1877-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906759517-paul-lindaus-zeitschrift-nord-und-sued-und-julius-rodenbergs-deutsche-rundschau-dokumentation</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906759517.jpg?v=1767770791</image:loc>
      <image:title>Die Rundschau-Debatte 1877</image:title>
      <image:caption>Book cover of: Die Rundschau-Debatte 1877</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-russische-akademiegrammatik-von-1802-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876902371-eine-sprachwissenschaftliche-analyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876902371.jpg?v=1767770789</image:loc>
      <image:title>Die russische Akademiegrammatik von 1802</image:title>
      <image:caption>Book cover of: Die russische Akademiegrammatik von 1802</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-renaissance-england-taylor-francis-ltd-9780415429023-kenneth-charlton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415429023.jpg?v=1767770789</image:loc>
      <image:title>Education in Renaissance England</image:title>
      <image:caption>Book cover of: Education in Renaissance England. By: Kenneth Charlton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-political-science-taylor-francis-ltd-9780415848428-discovering-a-neglected-field-anja-p-jakobi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415848428.jpg?v=1767770792</image:loc>
      <image:title>Education in Political Science</image:title>
      <image:caption>Book cover of: Education in Political Science. By: Anja P. Jakobi</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-russische-orthodoxe-kirche-in-der-gegenwart-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876901480-beitraege-zu-einem-symposium-der-deutschen-gesellschaft-fuer-osteuropakunde</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876901480.jpg?v=1767770789</image:loc>
      <image:title>Die Russische Orthodoxe Kirche in der Gegenwart</image:title>
      <image:caption>Book cover of: Die Russische Orthodoxe Kirche in der Gegenwart</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-renaissance-england-taylor-francis-ltd-9780415860543-kenneth-charlton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415860543.jpg?v=1767770789</image:loc>
      <image:title>Education in Renaissance England</image:title>
      <image:caption>Book cover of: Education in Renaissance England. By: Kenneth Charlton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-political-science-taylor-francis-ltd-9780415494779-discovering-a-neglected-field</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415494779.jpg?v=1767770790</image:loc>
      <image:title>Education in Political Science</image:title>
      <image:caption>Book cover of: Education in Political Science</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-modern-egypt-rle-egypt-taylor-francis-ltd-9780415811118-ideals-and-realities-georgie-d-m-hyde</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415811118.jpg?v=1767770791</image:loc>
      <image:title>Education in Modern Egypt (RLE Egypt)</image:title>
      <image:caption>Book cover of: Education in Modern Egypt (RLE Egypt). By: Georgie D. M. Hyde</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-the-global-city-taylor-francis-ltd-9781138182554-the-manufacturing-of-education-in-singapore-aaron-koh</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138182554.jpg?v=1767770792</image:loc>
      <image:title>Education in the Global City</image:title>
      <image:caption>Book cover of: Education in the Global City. By: Aaron Koh</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rueckforderung-gemeinschaftsrechtswidriger-staatlicher-beihilfen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631494912</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631494912.jpg?v=1767770792</image:loc>
      <image:title>Die Rueckforderung gemeinschaftsrechtswidriger staatlicher Beihilfen</image:title>
      <image:caption>Book cover of: Die Rueckforderung gemeinschaftsrechtswidriger staatlicher Beihilfen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-popular-culture-taylor-francis-ltd-9780415332422-telling-tales-on-teachers-and-learners-roy-fisher</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415332422.jpg?v=1767770791</image:loc>
      <image:title>Education in Popular Culture</image:title>
      <image:caption>Book cover of: Education in Popular Culture. By: Roy Fisher</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-scotland-taylor-francis-ltd-9780415158367-policy-and-practice-from-pre-school-to-secondary-margaret-clark</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415158367.jpg?v=1767770792</image:loc>
      <image:title>Education in Scotland</image:title>
      <image:caption>Book cover of: Education in Scotland. By: Margaret Clark</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-popular-culture-taylor-francis-ltd-9780415332415-telling-tales-on-teachers-and-learners-roy-fisher</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415332415.jpg?v=1767770792</image:loc>
      <image:title>Education in Popular Culture</image:title>
      <image:caption>Book cover of: Education in Popular Culture. By: Roy Fisher</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-romane-saul-bellows-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820467154-neue-dimensionen-des-pikaroromans</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820467154.jpg?v=1767770791</image:loc>
      <image:title>Die Romane Saul Bellows</image:title>
      <image:caption>Book cover of: Die Romane Saul Bellows</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-modern-china-taylor-francis-ltd-9781138968400-r-f-price</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138968400.jpg?v=1767770790</image:loc>
      <image:title>Education in Modern China</image:title>
      <image:caption>Book cover of: Education in Modern China. By: R. F. Price</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-spite-of-policy-taylor-francis-ltd-9781138049864-robin-alexander</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138049864.jpg?v=1767770791</image:loc>
      <image:title>Education in Spite of Policy</image:title>
      <image:caption>Book cover of: Education in Spite of Policy. By: Robin Alexander</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-morality-taylor-francis-ltd-9780415153652</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415153652.jpg?v=1767770792</image:loc>
      <image:title>Education in Morality</image:title>
      <image:caption>Book cover of: Education in Morality</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-nineteenth-century-british-literature-taylor-francis-ltd-9780367175757-exclusion-as-innovation-sheila-cordner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367175757.jpg?v=1767770791</image:loc>
      <image:title>Education in Nineteenth-Century British Literature</image:title>
      <image:caption>Book cover of: Education in Nineteenth-Century British Literature. By: Sheila Cordner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rosales-romane-francisco-sionil-joses-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631302194-die-suche-nach-nationaler-identitaet-in-der-philippinischen-literatur</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631302194.jpg?v=1767770790</image:loc>
      <image:title>Die Rosales-Romane Francisco Sionil Joses</image:title>
      <image:caption>Book cover of: Die Rosales-Romane Francisco Sionil Joses</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-israel-ils-222-taylor-francis-ltd-9780415177580-j-bentwich</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415177580.jpg?v=1767770790</image:loc>
      <image:title>Education in Israel ILS 222</image:title>
      <image:caption>Book cover of: Education in Israel ILS 222. By: J. Bentwich</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-modern-china-taylor-francis-ltd-9780415361675-r-f-price</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415361675.jpg?v=1767770791</image:loc>
      <image:title>Education in Modern China</image:title>
      <image:caption>Book cover of: Education in Modern China. By: R.F. Price</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rollenbeurteilung-von-handelsvertretungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820457001-eine-empirische-untersuchung-zur-einschaetzung-des-dienstleistungsangebotes-durch-industrie-und-handel</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820457001.jpg?v=1767770793</image:loc>
      <image:title>Die Rollenbeurteilung von Handelsvertretungen</image:title>
      <image:caption>Book cover of: Die Rollenbeurteilung von Handelsvertretungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-von-joint-ventures-im-transformationsproze-osteuropas-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631485231-am-beispiel-der-russischen-foederation</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631485231.jpg?v=1767770792</image:loc>
      <image:title>Die Rolle von Joint Ventures im Transformationsproze Osteuropas</image:title>
      <image:caption>Book cover of: Die Rolle von Joint Ventures im Transformationsproze Osteuropas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-romankunst-ivan-vazovs-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783876900247-epische-studien-wolfgang-gesemann</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783876900247.jpg?v=1767770791</image:loc>
      <image:title>Die Romankunst Ivan Vazovs</image:title>
      <image:caption>Book cover of: Die Romankunst Ivan Vazovs. By: Wolfgang Gesemann</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-des-einzelhandels-bei-der-entwicklung-des-konsumentenverhaltens-in-den-neuen-bundeslaendern-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631325100-thomas-nassua</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631325100.jpg?v=1767770792</image:loc>
      <image:title>Die Rolle des Einzelhandels bei der Entwicklung des Konsumentenverhaltens in den neuen Bundeslaendern</image:title>
      <image:caption>Book cover of: Die Rolle des Einzelhandels bei der Entwicklung des Konsumentenverhaltens in den neuen Bundeslaendern. By: Thomas Nassua</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-des-bauherrn-im-planungs-und-bauprozess-peter-lang-gmbh-9783820477528-2-unveraenderte-auflage-ludwig-will</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820477528.jpg?v=1767770794</image:loc>
      <image:title>Die Rolle Des Bauherrn Im Planungs- Und Bauprozess</image:title>
      <image:caption>Book cover of: Die Rolle Des Bauherrn Im Planungs- Und Bauprozess. By: Ludwig Will</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-der-thrombozyten-bei-der-athero-und-thrombogenese-vs-verlag-fur-sozialwissenschaften-9783663017554-295-sitzung-am-3-marz-1982-in-dusseldorf-gustav-born</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783663017554.jpg?v=1767770790</image:loc>
      <image:title>Die Rolle der Thrombozyten bei der Athero- und Thrombogenese</image:title>
      <image:caption>Book cover of: Die Rolle der Thrombozyten bei der Athero- und Thrombogenese. By: Gustav Born</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-der-investition-in-der-planwirtschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631452899</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631452899.jpg?v=1767770790</image:loc>
      <image:title>Die Rolle der Investition in der Planwirtschaft</image:title>
      <image:caption>Book cover of: Die Rolle der Investition in der Planwirtschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-der-russischen-streitkraefte-im-politischen-system-der-russischen-foederation-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631351710</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631351710.jpg?v=1767770792</image:loc>
      <image:title>Die Rolle der russischen Streitkraefte im politischen System der Russischen Foederation</image:title>
      <image:caption>Book cover of: Die Rolle der russischen Streitkraefte im politischen System der Russischen Foederation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rueckdeckungsversicherung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631431344-aus-zivil-versicherungs-und-arbeitsrechtlicher-sicht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631431344.jpg?v=1767770793</image:loc>
      <image:title>Die Rueckdeckungsversicherung</image:title>
      <image:caption>Book cover of: Die Rueckdeckungsversicherung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-israel-ils-222-taylor-francis-ltd-9781138882027-jose-bentwich</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138882027.jpg?v=1767770791</image:loc>
      <image:title>Education in Israel ILS 222</image:title>
      <image:caption>Book cover of: Education in Israel ILS 222. By: Jose Bentwich</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rocambole-romane-von-ponson-du-terrail-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820455052-studien-zur-geschichte-des-franzoesischen-feuilletonromans</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820455052.jpg?v=1767770793</image:loc>
      <image:title>Die Rocambole-Romane von Ponson du Terrail</image:title>
      <image:caption>Book cover of: Die Rocambole-Romane von Ponson du Terrail</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-germany-taylor-francis-ltd-9780415113977-tradition-and-reform-in-historical-context-david-phillips</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415113977.jpg?v=1767770792</image:loc>
      <image:title>Education in Germany</image:title>
      <image:caption>Book cover of: Education in Germany. By: David Phillips</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-heart-volume-2-john-wiley-sons-inc-9780727916631-peter-mills</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780727916631.jpg?v=1767770793</image:loc>
      <image:title>Education in Heart, Volume 2</image:title>
      <image:caption>Book cover of: Education in Heart, Volume 2. By: Peter Mills</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-der-geld-und-fiskalpolitik-bei-flexiblen-wechselkursen-unter-spezieller-beruecksichtigung-der-internationalen-finanzmarktstruktur-und-von-lohnrigiditaeten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631443897</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631443897.jpg?v=1767770793</image:loc>
      <image:title>Die Rolle der Geld- und Fiskalpolitik bei flexiblen Wechselkursen unter spezieller Beruecksichtigung der internationalen Finanzmarktstruktur und von Lohnrigiditaeten</image:title>
      <image:caption>Book cover of: Die Rolle der Geld- und Fiskalpolitik bei flexiblen Wechselkursen unter spezieller Beruecksichtigung der internationalen Finanzmarktstruktur und von Lohnrigiditaeten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-des-beirates-bei-der-fuehrung-von-mittelbetrieben-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820412772</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820412772.jpg?v=1767770792</image:loc>
      <image:title>Die Rolle des Beirates bei der Fuehrung von Mittelbetrieben</image:title>
      <image:caption>Book cover of: Die Rolle des Beirates bei der Fuehrung von Mittelbetrieben</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-romer-fur-dummies-wiley-vch-verlag-gmbh-9783527703838-guy-de-la-be-doye-re</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783527703838.jpg?v=1767770797</image:loc>
      <image:title>Die Romer fur Dummies</image:title>
      <image:caption>Book cover of: Die Romer fur Dummies. By: Guy de la Bédoyère</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-romane-e-l-doctorows-im-kontext-des-postmodernism-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631461921</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631461921.jpg?v=1767770792</image:loc>
      <image:title>Die Romane E. L. Doctorows im Kontext des «postmodernism»</image:title>
      <image:caption>Book cover of: Die Romane E. L. Doctorows im Kontext des «postmodernism»</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-egypt-rle-egypt-taylor-francis-ltd-9780415811095-judith-cochran</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415811095.jpg?v=1767770791</image:loc>
      <image:title>Education in Egypt (RLE Egypt)</image:title>
      <image:caption>Book cover of: Education in Egypt (RLE Egypt). By: Judith Cochran</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-heart-john-wiley-sons-inc-9780727917645-peter-mills</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780727917645.jpg?v=1767770793</image:loc>
      <image:title>Education In Heart</image:title>
      <image:caption>Book cover of: Education In Heart. By: Peter Mills</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-zwischenstaatlicher-vereinbarungen-im-system-der-europaeischen-gemeinschaften-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820463590</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820463590.jpg?v=1767770794</image:loc>
      <image:title>Die Rolle zwischenstaatlicher Vereinbarungen im System der europaeischen Gemeinschaften</image:title>
      <image:caption>Book cover of: Die Rolle zwischenstaatlicher Vereinbarungen im System der europaeischen Gemeinschaften</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-facebook-taylor-francis-ltd-9780415713177-higher-education-and-the-world-s-largest-social-network-mike-kent</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415713177.jpg?v=1767770792</image:loc>
      <image:title>Education in Facebook?</image:title>
      <image:caption>Book cover of: Education in Facebook?. By: Mike Kent</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-east-jerusalem-taylor-francis-inc-9780815352372-occupation-political-power-and-struggle-samira-alayan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815352372.jpg?v=1767770793</image:loc>
      <image:title>Education in East Jerusalem</image:title>
      <image:caption>Book cover of: Education in East Jerusalem. By: Samira Alayan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-der-ziegenmilch-in-der-saeuglingsernaehrung-des-19-und-20-jahrhunderts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631361894</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631361894.jpg?v=1767770793</image:loc>
      <image:title>Die Rolle der Ziegenmilch in der Saeuglingsernaehrung des 19. und 20. Jahrhunderts</image:title>
      <image:caption>Book cover of: Die Rolle der Ziegenmilch in der Saeuglingsernaehrung des 19. und 20. Jahrhunderts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-facebook-taylor-francis-ltd-9780415713191-higher-education-and-the-world-s-largest-social-network-mike-kent</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415713191.jpg?v=1767770794</image:loc>
      <image:title>Education in Facebook?</image:title>
      <image:caption>Book cover of: Education in Facebook?. By: Mike Kent</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-der-finanziellen-forschungsfoerderung-bei-der-entstehung-von-neuen-technologisch-und-wirtschaftlich-bedeutsamen-innovationen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631406854-theoretische-ueberlegungen-und-fallstudien-aus-d</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631406854.jpg?v=1767770794</image:loc>
      <image:title>Die Rolle der finanziellen Forschungsfoerderung bei der Entstehung von neuen, technologisch und wirtschaftlich bedeutsamen Innovationen</image:title>
      <image:caption>Book cover of: Die Rolle der finanziellen Forschungsfoerderung bei der Entstehung von neuen, technologisch und wirtschaftlich bedeutsamen Innovationen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-globalization-university-press-of-america-9780761838180-paul-c-mocombe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780761838180.jpg?v=1767770793</image:loc>
      <image:title>Education in Globalization</image:title>
      <image:caption>Book cover of: Education in Globalization. By: Paul C. Mocombe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-von-ereignisdetails-bei-der-erinnerung-an-datum-und-dauer-oeffentlicher-ereignisse-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631484975-zur-funktion-von-erinnerungserfahrungen-bei-der-zeitlichen-verortung-von-begebenheiten</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631484975.jpg?v=1767770793</image:loc>
      <image:title>Die Rolle von Ereignisdetails bei der Erinnerung an Datum und Dauer oeffentlicher Ereignisse</image:title>
      <image:caption>Book cover of: Die Rolle von Ereignisdetails bei der Erinnerung an Datum und Dauer oeffentlicher Ereignisse</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-der-geige-im-jazz-peter-lang-international-academic-publishers-9783261044075</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261044075.jpg?v=1767770793</image:loc>
      <image:title>Die Rolle der Geige im Jazz</image:title>
      <image:caption>Book cover of: Die Rolle der Geige im Jazz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-france-taylor-francis-ltd-9780415112383-continuity-and-change-in-the-mitterrand-years-1981-1995-bob-moon</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415112383.jpg?v=1767770792</image:loc>
      <image:title>Education in France</image:title>
      <image:caption>Book cover of: Education in France. By: Bob Moon</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-computer-generated-environments-taylor-francis-ltd-9780415634021</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415634021.jpg?v=1767770792</image:loc>
      <image:title>Education in Computer Generated Environments</image:title>
      <image:caption>Book cover of: Education in Computer Generated Environments</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-china-since-1976-mcfarland-co-inc-9780786413942-xiufang-wang</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780786413942.jpg?v=1767770794</image:loc>
      <image:title>Education in China Since 1976</image:title>
      <image:caption>Book cover of: Education in China Since 1976. By: Xiufang Wang</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-romane-robert-herricks-peter-lang-international-academic-publishers-9783261026040-empirie-und-fiktion</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261026040.jpg?v=1767770793</image:loc>
      <image:title>Die Romane Robert Herricks</image:title>
      <image:caption>Book cover of: Die Romane Robert Herricks</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-risiko-und-lastenverteilung-im-mutterschutzrecht-peter-lang-ag-9783631384459-unter-besonderer-beruecksichtigung-der-kostenbelastung-der-arbeitgeber-elke-winkler</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631384459.jpg?v=1767770795</image:loc>
      <image:title>Die Risiko- Und Lastenverteilung Im Mutterschutzrecht</image:title>
      <image:caption>Book cover of: Die Risiko- Und Lastenverteilung Im Mutterschutzrecht. By: Elke Winkler</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rezeption-nordamerikanischer-architektur-um-1900-in-deutschland-und-oesterreich-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783899755596-claudia-sohst</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783899755596.jpg?v=1767770793</image:loc>
      <image:title>Die Rezeption Nordamerikanischer Architektur Um 1900 in Deutschland Und Oesterreich</image:title>
      <image:caption>Book cover of: Die Rezeption Nordamerikanischer Architektur Um 1900 in Deutschland Und Oesterreich. By: Claudia Sohst</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-england-and-wales-taylor-francis-inc-9780815368854-an-annotated-bibliography-franklin-parker</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815368854.jpg?v=1767770795</image:loc>
      <image:title>Education in England and Wales</image:title>
      <image:caption>Book cover of: Education in England and Wales. By: Franklin Parker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-egypt-rle-egypt-taylor-francis-ltd-9781138008755-judith-cochran</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138008755.jpg?v=1767770797</image:loc>
      <image:title>Education in Egypt (RLE Egypt)</image:title>
      <image:caption>Book cover of: Education in Egypt (RLE Egypt). By: Judith Cochran</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-der-elektronischen-medien-in-der-entwicklung-der-kuenste-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820409253-herausgegeben-von-alphons-silbermann</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820409253.jpg?v=1767770795</image:loc>
      <image:title>Die Rolle der elektronischen Medien in der Entwicklung der Kuenste</image:title>
      <image:caption>Book cover of: Die Rolle der elektronischen Medien in der Entwicklung der Kuenste</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rhetorik-in-der-sonettkunst-von-jones-very-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820477986</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820477986.jpg?v=1767770798</image:loc>
      <image:title>Die Rhetorik in der Sonettkunst von Jones Very</image:title>
      <image:caption>Book cover of: Die Rhetorik in der Sonettkunst von Jones Very</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rezeption-stephen-cranes-in-deutschland-peter-lang-international-academic-publishers-9783261023292</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261023292.jpg?v=1767770795</image:loc>
      <image:title>Die Rezeption Stephen Cranes in Deutschland</image:title>
      <image:caption>Book cover of: Die Rezeption Stephen Cranes in Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-cyberspace-taylor-francis-ltd-9780415328821-ray-land</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415328821.jpg?v=1767770793</image:loc>
      <image:title>Education in Cyberspace</image:title>
      <image:caption>Book cover of: Education in Cyberspace. By: Ray Land</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rolle-der-finanzorganisationen-in-ostmittel-und-suedosteuropa-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631743195</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631743195.jpg?v=1767770794</image:loc>
      <image:title>Die Rolle der Finanzorganisationen in Ostmittel- und Suedosteuropa</image:title>
      <image:caption>Book cover of: Die Rolle der Finanzorganisationen in Ostmittel- und Suedosteuropa</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-contemporary-japan-cambridge-university-press-9780521626866-inequality-and-diversity</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521626866.jpg?v=1767770795</image:loc>
      <image:title>Education in Contemporary Japan</image:title>
      <image:caption>Book cover of: Education in Contemporary Japan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rezeption-des-tristanstoffs-in-frankreich-vom-ende-des-18-bis-zum-beginn-des-20-jahrhunderts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631406830</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631406830.jpg?v=1767770797</image:loc>
      <image:title>Die Rezeption des Tristanstoffs in Frankreich vom Ende des 18. bis zum Beginn des 20. Jahrhunderts</image:title>
      <image:caption>Book cover of: Die Rezeption des Tristanstoffs in Frankreich vom Ende des 18. bis zum Beginn des 20. Jahrhunderts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rheinland-pfaelzischen-gemeinden-im-system-des-finanzausgleichs-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631498248</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631498248.jpg?v=1767770794</image:loc>
      <image:title>Die rheinland-pfaelzischen Gemeinden im System des Finanzausgleichs</image:title>
      <image:caption>Book cover of: Die rheinland-pfaelzischen Gemeinden im System des Finanzausgleichs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-england-and-wales-taylor-francis-inc-9780815368830-an-annotated-bibliography-franklin-parker</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815368830.jpg?v=1767770797</image:loc>
      <image:title>Education in England and Wales</image:title>
      <image:caption>Book cover of: Education in England and Wales. By: Franklin Parker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-china-john-wiley-and-sons-ltd-9780745664101-philosophy-politics-and-culture-janette-ryan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780745664101.jpg?v=1767770793</image:loc>
      <image:title>Education in China</image:title>
      <image:caption>Book cover of: Education in China. By: Janette Ryan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-risikoverteilung-bei-der-benutzung-elektronischer-kartengesteuerter-zahlungssysteme-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631450796-dargestellt-am-beispiel-des-geldausgabeautomaten</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631450796.jpg?v=1767770795</image:loc>
      <image:title>Die Risikoverteilung bei der Benutzung elektronischer kartengesteuerter Zahlungssysteme</image:title>
      <image:caption>Book cover of: Die Risikoverteilung bei der Benutzung elektronischer kartengesteuerter Zahlungssysteme</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rezeption-goethes-bei-wilhelm-flitner-verlag-peter-lang-9783906754215-zur-motivgeschichte-der-hermeneutisch-pragmatischen-paedagogik-christoph-przybilka</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906754215.jpg?v=1767770795</image:loc>
      <image:title>Die Rezeption Goethes Bei Wilhelm Flitner</image:title>
      <image:caption>Book cover of: Die Rezeption Goethes Bei Wilhelm Flitner. By: Christoph Przybilka</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-contemporary-japan-cambridge-university-press-9780521622523-inequality-and-diversity</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521622523.jpg?v=1767770798</image:loc>
      <image:title>Education in Contemporary Japan</image:title>
      <image:caption>Book cover of: Education in Contemporary Japan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-cyberspace-taylor-francis-ltd-9780415649162-sian-bayne</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415649162.jpg?v=1767770795</image:loc>
      <image:title>Education in Cyberspace</image:title>
      <image:caption>Book cover of: Education in Cyberspace. By: Sian Bayne</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rezeption-europaeischer-und-amerikanischer-lyrik-in-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631316214</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631316214.jpg?v=1767770796</image:loc>
      <image:title>Die Rezeption europaeischer und amerikanischer Lyrik in Deutschland</image:title>
      <image:caption>Book cover of: Die Rezeption europaeischer und amerikanischer Lyrik in Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rezeption-des-italienischen-futurismus-im-spiegel-der-deutschen-expressionistischen-prosa-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783899757026-sara-terpin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783899757026.jpg?v=1767770795</image:loc>
      <image:title>Die Rezeption Des Italienischen Futurismus Im Spiegel Der Deutschen Expressionistischen Prosa</image:title>
      <image:caption>Book cover of: Die Rezeption Des Italienischen Futurismus Im Spiegel Der Deutschen Expressionistischen Prosa. By: Sara Terpin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-an-age-of-nihilism-taylor-francis-ltd-9780750710176-education-and-moral-standards</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750710176.jpg?v=1767770794</image:loc>
      <image:title>Education in an Age of Nihilism</image:title>
      <image:caption>Book cover of: Education in an Age of Nihilism</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rezeption-heidnischen-denkens-im-werk-charles-cotins-peter-lang-ag-9783631332030-ein-beispiel-popularphilosophischer-textproduktion-im-grand-siecle</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631332030.jpg?v=1767770796</image:loc>
      <image:title>Die Rezeption heidnischen Denkens im Werk Charles Cotins</image:title>
      <image:caption>Book cover of: Die Rezeption heidnischen Denkens im Werk Charles Cotins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-britain-since-1944-taylor-francis-ltd-9780415761789-w-kenneth-richmond</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415761789.jpg?v=1767770795</image:loc>
      <image:title>Education in Britain Since 1944</image:title>
      <image:caption>Book cover of: Education in Britain Since 1944. By: W. Kenneth Richmond</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-community-psychology-taylor-francis-inc-9780789003157-models-for-graduate-and-undergraduate-programs</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789003157.jpg?v=1767770795</image:loc>
      <image:title>Education in Community Psychology</image:title>
      <image:caption>Book cover of: Education in Community Psychology</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-america-university-of-california-press-9780520285101-kimberly-goyette</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780520285101.jpg?v=1767770795</image:loc>
      <image:title>Education in America</image:title>
      <image:caption>Book cover of: Education in America. By: Kimberly Goyette</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-britain-since-1944-taylor-francis-ltd-9780415432771-w-k-richmond</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415432771.jpg?v=1767770793</image:loc>
      <image:title>Education in Britain Since 1944</image:title>
      <image:caption>Book cover of: Education in Britain Since 1944. By: W. K. Richmond</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-a-free-society-liberty-fund-inc-9780913966457-anne-husted-burleigh</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780913966457.jpg?v=1767770797</image:loc>
      <image:title>Education in a Free Society</image:title>
      <image:caption>Book cover of: Education in a Free Society. By: Anne Husted Burleigh</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-a-single-europe-taylor-francis-ltd-9780415164412-colin-brock</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415164412.jpg?v=1767770797</image:loc>
      <image:title>Education in a Single Europe</image:title>
      <image:caption>Book cover of: Education in a Single Europe. By: Colin Brock</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-a-globalized-world-bloomsbury-publishing-plc-9780742510982-the-connectivity-of-economic-power-technology-and-knowledge-nelly-p-stromquist</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780742510982.jpg?v=1767770794</image:loc>
      <image:title>Education in a Globalized World</image:title>
      <image:caption>Book cover of: Education in a Globalized World. By: Nelly P. Stromquist</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-a-post-welfare-society-open-university-press-9780335217533-sally-tomlinson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780335217533.jpg?v=1767770796</image:loc>
      <image:title>Education in a Post Welfare Society</image:title>
      <image:caption>Book cover of: Education in a Post Welfare Society. By: Sally Tomlinson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-a-new-society-the-university-of-chicago-press-9780226517391-renewing-the-sociology-of-education</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226517391.jpg?v=1767770798</image:loc>
      <image:title>Education in a New Society</image:title>
      <image:caption>Book cover of: Education in a New Society</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-an-age-of-nihilism-taylor-francis-ltd-9780750710169-education-and-moral-standards</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750710169.jpg?v=1767770796</image:loc>
      <image:title>Education in an Age of Nihilism</image:title>
      <image:caption>Book cover of: Education in an Age of Nihilism</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-resistenz-der-ungleichheit-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631318348-zur-entwicklungsdynamik-der-privatisierung-im-tuerkischen-bildungswesen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631318348.jpg?v=1767770795</image:loc>
      <image:title>Die Resistenz der Ungleichheit</image:title>
      <image:caption>Book cover of: Die Resistenz der Ungleichheit</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-afghanistan-taylor-francis-inc-9780815361053-developments-influences-and-legacies-since-1901-yahia-baiza</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815361053.jpg?v=1767770796</image:loc>
      <image:title>Education in Afghanistan</image:title>
      <image:caption>Book cover of: Education in Afghanistan. By: Yahia Baiza</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-afghanistan-taylor-francis-ltd-9780415621991-developments-influences-and-legacies-since-1901-yahia-baiza</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415621991.jpg?v=1767770799</image:loc>
      <image:title>Education in Afghanistan</image:title>
      <image:caption>Book cover of: Education in Afghanistan. By: Yahia Baiza</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-restauration-des-schonen-springer-verlag-berlin-and-heidelberg-gmbh-co-kg-9783476999108-stifters-nachsommer-horst-albert-glaser</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783476999108.jpg?v=1767770795</image:loc>
      <image:title>Die Restauration des Schonen</image:title>
      <image:caption>Book cover of: Die Restauration des Schonen. By: Horst Albert Glaser</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reservenbesteuerung-bei-der-verlegung-juristischer-personen-peter-lang-international-academic-publishers-9783261010216-louis-balthasar</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261010216.jpg?v=1767770794</image:loc>
      <image:title>Die Reservenbesteuerung bei der Verlegung juristischer Personen</image:title>
      <image:caption>Book cover of: Die Reservenbesteuerung bei der Verlegung juristischer Personen. By: Louis Balthasar</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-a-digital-world-taylor-francis-ltd-9780415808453-global-perspectives-on-technology-and-education-neil-selwyn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415808453.jpg?v=1767770796</image:loc>
      <image:title>Education in a Digital World</image:title>
      <image:caption>Book cover of: Education in a Digital World. By: Neil Selwyn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-a-free-society-liberty-fund-inc-9780913966006</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780913966006.jpg?v=1767770795</image:loc>
      <image:title>Education in a Free Society</image:title>
      <image:caption>Book cover of: Education in a Free Society</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reputation-einer-zentralbank-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631321232-eine-theoretische-untersuchung-unter-besonderer-beruecksichtigung-der-europaeischen-zentralbank-iris-henning</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631321232.jpg?v=1767770796</image:loc>
      <image:title>Die Reputation einer Zentralbank</image:title>
      <image:caption>Book cover of: Die Reputation einer Zentralbank. By: Iris Henning</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-a-digital-world-taylor-francis-ltd-9780415808446-global-perspectives-on-technology-and-education-neil-selwyn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415808446.jpg?v=1767770798</image:loc>
      <image:title>Education in a Digital World</image:title>
      <image:caption>Book cover of: Education in a Digital World. By: Neil Selwyn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rezeption-des-werkes-von-jacques-brel-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631429365</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631429365.jpg?v=1767770795</image:loc>
      <image:title>Die Rezeption des Werkes von Jacques Brel</image:title>
      <image:caption>Book cover of: Die Rezeption des Werkes von Jacques Brel</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-china-john-wiley-and-sons-ltd-9780745664088-philosophy-politics-and-culture-janette-ryan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780745664088.jpg?v=1767770800</image:loc>
      <image:title>Education in China</image:title>
      <image:caption>Book cover of: Education in China. By: Janette Ryan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-restrukturierung-der-britischen-stahlindustrie-die-standortentwicklung-der-british-steel-corporation-im-zeitverlauf-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631430316</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631430316.jpg?v=1767770795</image:loc>
      <image:title>Die Restrukturierung der britischen Stahlindustrie - Die Standortentwicklung der British Steel Corporation im Zeitverlauf</image:title>
      <image:caption>Book cover of: Die Restrukturierung der britischen Stahlindustrie - Die Standortentwicklung der British Steel Corporation im Zeitverlauf</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reptilien-der-schweiz-les-reptiles-de-suisse-i-rettili-della-svizzera-birkhauser-basel-9783034895149-verbreitung-lebensraume-schutz-repartition-habitats-protection-distribuzione-habitat-protezione-ulrich-hofer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783034895149.jpg?v=1767770796</image:loc>
      <image:title>Die Reptilien der Schweiz / Les reptiles de Suisse / I rettili della Svizzera</image:title>
      <image:caption>Book cover of: Die Reptilien der Schweiz / Les reptiles de Suisse / I rettili della Svizzera. By: Ulrich Hofer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-repraesentation-von-managementwissen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631496237-die-modellierung-von-wissen-fuer-das-management-von-expertensystemprojekten-gemae-dem-kads-ansatz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631496237.jpg?v=1767770795</image:loc>
      <image:title>Die Repraesentation von Managementwissen</image:title>
      <image:caption>Book cover of: Die Repraesentation von Managementwissen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-a-new-society-the-university-of-chicago-press-9780226517421-renewing-the-sociology-of-education</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780226517421.jpg?v=1767770796</image:loc>
      <image:title>Education in a New Society</image:title>
      <image:caption>Book cover of: Education in a New Society</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-a-single-europe-taylor-francis-ltd-9780415164405-colin-brock</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415164405.jpg?v=1767770799</image:loc>
      <image:title>Education in a Single Europe</image:title>
      <image:caption>Book cover of: Education in a Single Europe. By: Colin Brock</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-wicked-problems-and-the-reconciliation-of-opposites-taylor-francis-ltd-9781138962859-a-theory-of-bi-relational-development-raoul-adam</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138962859.jpg?v=1767770796</image:loc>
      <image:title>Education for Wicked Problems and the Reconciliation of Opposites</image:title>
      <image:caption>Book cover of: Education for Wicked Problems and the Reconciliation of Opposites. By: Raoul Adam</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-repraesentation-anschaulicher-information-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820493641-eine-experimentelle-studie-zur-kognitiven-psychologie-ueber-die-identifizierung-modalitaetsspezifischer-repraesentationssysteme</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820493641.jpg?v=1767770797</image:loc>
      <image:title>Die Repraesentation anschaulicher Information</image:title>
      <image:caption>Book cover of: Die Repraesentation anschaulicher Information</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-governance-for-the-twenty-first-century-bloomsbury-publishing-plc-9780815723943-overcoming-the-structural-barriers-to-school-reform</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815723943.jpg?v=1767770796</image:loc>
      <image:title>Education Governance for the Twenty-First Century</image:title>
      <image:caption>Book cover of: Education Governance for the Twenty-First Century</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-values-taylor-francis-ltd-9781138173156-morals-ethics-and-citizenship-in-contemporary-teaching-jo-cairns</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138173156.jpg?v=1767770796</image:loc>
      <image:title>Education for Values</image:title>
      <image:caption>Book cover of: Education for Values. By: Jo Cairns</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rezeption-der-us-amerikanischen-literatur-der-postmoderne-im-deutschsprachigen-raum-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631439180</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631439180.jpg?v=1767770796</image:loc>
      <image:title>Die Rezeption der US-amerikanischen Literatur der Postmoderne im deutschsprachigen Raum</image:title>
      <image:caption>Book cover of: Die Rezeption der US-amerikanischen Literatur der Postmoderne im deutschsprachigen Raum</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-wicked-problems-and-the-reconciliation-of-opposites-taylor-francis-inc-9780815359920-a-theory-of-bi-relational-development-raoul-j-adam</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815359920.jpg?v=1767770797</image:loc>
      <image:title>Education for Wicked Problems and the Reconciliation of Opposites</image:title>
      <image:caption>Book cover of: Education for Wicked Problems and the Reconciliation of Opposites. By: Raoul J. Adam</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-gospel-harvard-university-press-9780674025455-the-economic-power-of-schooling-w-norton-grubb</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780674025455.jpg?v=1767770796</image:loc>
      <image:title>Education Gospel</image:title>
      <image:caption>Book cover of: Education Gospel. By: W. Norton Grubb</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-in-a-federal-uk-taylor-francis-inc-9780815373148-john-furlong</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815373148.jpg?v=1767770799</image:loc>
      <image:title>Education in a Federal UK</image:title>
      <image:caption>Book cover of: Education in a Federal UK. By: John Furlong</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reparaturkostenversicherung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631363294</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631363294.jpg?v=1767770796</image:loc>
      <image:title>Die Reparaturkostenversicherung</image:title>
      <image:caption>Book cover of: Die Reparaturkostenversicherung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-revisibilitaet-der-auslegung-individueller-vertragserklaerungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820413892</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820413892.jpg?v=1767770797</image:loc>
      <image:title>Die Revisibilitaet der Auslegung individueller Vertragserklaerungen</image:title>
      <image:caption>Book cover of: Die Revisibilitaet der Auslegung individueller Vertragserklaerungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-values-kogan-page-ltd-9780749439446-morals-ethics-and-citizenship-in-contemporary-teaching-roy-gardner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780749439446.jpg?v=1767770797</image:loc>
      <image:title>Education for Values</image:title>
      <image:caption>Book cover of: Education for Values. By: Roy Gardner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rentenreform-in-peru-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631333754-auswirkungen-auf-soziale-sicherung-finanzmaerkte-und-staatsfinanzen-manfred-kiefer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631333754.jpg?v=1767770797</image:loc>
      <image:title>Die Rentenreform in Peru</image:title>
      <image:caption>Book cover of: Die Rentenreform in Peru. By: Manfred Kiefer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reorganisation-beruflicher-weiterbildung-im-regionalen-transformationsproze-der-neuen-bundeslaender-destruktion-und-konstruktion-im-wechselspiel-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631497838-eine-empirische-untersuchung-von-i</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631497838.jpg?v=1767770796</image:loc>
      <image:title>Die Reorganisation beruflicher Weiterbildung im regionalen Transformationsproze der Neuen Bundeslaender: Destruktion und Konstruktion im Wechselspiel</image:title>
      <image:caption>Book cover of: Die Reorganisation beruflicher Weiterbildung im regionalen Transformationsproze der Neuen Bundeslaender: Destruktion und Konstruktion im Wechselspiel</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sustainable-human-and-environmental-systems-taylor-francis-inc-9780815399520-from-theory-to-practice-will-focht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815399520.jpg?v=1767770798</image:loc>
      <image:title>Education for Sustainable Human and Environmental Systems</image:title>
      <image:caption>Book cover of: Education for Sustainable Human and Environmental Systems. By: Will Focht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-religiositaet-und-das-thema-der-verfolgung-in-sechs-romanen-von-graham-greene-peter-lang-international-academic-publishers-9783261010827</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261010827.jpg?v=1767770798</image:loc>
      <image:title>Die Religiositaet und das Thema der Verfolgung in sechs Romanen von Graham Greene</image:title>
      <image:caption>Book cover of: Die Religiositaet und das Thema der Verfolgung in sechs Romanen von Graham Greene</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-relevanz-der-unternehmensordnung-fuer-den-wettbewerb-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631499801</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631499801.jpg?v=1767770797</image:loc>
      <image:title>Die Relevanz der Unternehmensordnung fuer den Wettbewerb</image:title>
      <image:caption>Book cover of: Die Relevanz der Unternehmensordnung fuer den Wettbewerb</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sustainable-development-in-the-postcolonial-world-taylor-francis-ltd-9780415792967-towards-a-transformative-agenda-for-africa-leon-tikly</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415792967.jpg?v=1767770797</image:loc>
      <image:title>Education for Sustainable Development in the Postcolonial World</image:title>
      <image:caption>Book cover of: Education for Sustainable Development in the Postcolonial World. By: Leon Tikly</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-groups-for-men-who-batter-springer-publishing-co-inc-9780826179906-the-duluth-model</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780826179906.jpg?v=1767770798</image:loc>
      <image:title>Education Groups for Men Who Batter</image:title>
      <image:caption>Book cover of: Education Groups for Men Who Batter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-renaissance-der-regionen-peter-lang-ag-9783631580424-neue-ansaetze-in-den-theorien-der-internationalen-beziehungen-regionaler-sicherheitskomplex-und-regionale-ordnungen-matthias-heise</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631580424.jpg?v=1767770798</image:loc>
      <image:title>Die Renaissance Der Regionen</image:title>
      <image:caption>Book cover of: Die Renaissance Der Regionen. By: Matthias Heise</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sustainable-happiness-and-well-being-taylor-francis-ltd-9781138640795-catherine-o-brien</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138640795.jpg?v=1767770802</image:loc>
      <image:title>Education for Sustainable Happiness and Well-Being</image:title>
      <image:caption>Book cover of: Education for Sustainable Happiness and Well-Being. By: Catherine O&apos;Brien</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sustainable-happiness-and-well-being-taylor-francis-ltd-9781138640801-catherine-o-brien</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138640801.jpg?v=1767770798</image:loc>
      <image:title>Education for Sustainable Happiness and Well-Being</image:title>
      <image:caption>Book cover of: Education for Sustainable Happiness and Well-Being. By: Catherine O&apos;Brien</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sustainable-development-taylor-francis-ltd-9780367220044-what-was-achieved-in-the-desd-roger-firth</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367220044.jpg?v=1767770797</image:loc>
      <image:title>Education for Sustainable Development</image:title>
      <image:caption>Book cover of: Education for Sustainable Development. By: Roger Firth</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sustainable-development-in-the-postcolonial-world-taylor-francis-ltd-9780415792943-towards-a-transformative-agenda-for-africa-leon-tikly</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415792943.jpg?v=1767770799</image:loc>
      <image:title>Education for Sustainable Development in the Postcolonial World</image:title>
      <image:caption>Book cover of: Education for Sustainable Development in the Postcolonial World. By: Leon Tikly</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-relevante-benutzungshandlung-im-deutschen-markenrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631313756-birgit-schulz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631313756.jpg?v=1767770798</image:loc>
      <image:title>Die relevante Benutzungshandlung im deutschen Markenrecht</image:title>
      <image:caption>Book cover of: Die relevante Benutzungshandlung im deutschen Markenrecht. By: Birgit Schulz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-relevanz-der-kantischen-ethik-fuer-das-theoretische-selbstverstaendnis-einer-emanzipatorischen-paedagogik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631318386</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631318386.jpg?v=1767770798</image:loc>
      <image:title>Die Relevanz der Kantischen Ethik fuer das theoretische Selbstverstaendnis einer emanzipatorischen Paedagogik</image:title>
      <image:caption>Book cover of: Die Relevanz der Kantischen Ethik fuer das theoretische Selbstverstaendnis einer emanzipatorischen Paedagogik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reise-als-flucht-peter-lang-international-academic-publishers-9783261009463-zu-schnabels-insel-felsenburg-und-thuemmels-reise-in-die-mittaeglichen-provinzen-von-frankreich</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261009463.jpg?v=1767770798</image:loc>
      <image:title>Die Reise als Flucht</image:title>
      <image:caption>Book cover of: Die Reise als Flucht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rekonstruktion-unverzerrter-kommunikation-und-interaktion-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820462319-versuch-einer-normativen-theorie-und-didaktik-literaturvermittelter-verstaendigung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820462319.jpg?v=1767770799</image:loc>
      <image:title>Die Rekonstruktion unverzerrter Kommunikation und Interaktion</image:title>
      <image:caption>Book cover of: Die Rekonstruktion unverzerrter Kommunikation und Interaktion</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-relevanz-nicht-tarifaerer-handelshemmnisse-im-internationalen-handel-und-ihre-wirkungen-auf-die-integration-der-entwicklungslaender-in-die-weltwirtschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820483444</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820483444.jpg?v=1767770797</image:loc>
      <image:title>Die Relevanz nicht-tarifaerer Handelshemmnisse im internationalen Handel und ihre Wirkungen auf die Integration der Entwicklungslaender in die Weltwirtschaft</image:title>
      <image:caption>Book cover of: Die Relevanz nicht-tarifaerer Handelshemmnisse im internationalen Handel und ihre Wirkungen auf die Integration der Entwicklungslaender in die Weltwirtschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-religiositaet-der-koreaner-in-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631306604</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631306604.jpg?v=1767770799</image:loc>
      <image:title>Die Religiositaet der Koreaner in Deutschland</image:title>
      <image:caption>Book cover of: Die Religiositaet der Koreaner in Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regulierung-des-mietwohnungsmarktes-in-der-bundesrepublik-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631309971-eine-positive-oekonomische-analyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631309971.jpg?v=1767770799</image:loc>
      <image:title>Die Regulierung des Mietwohnungsmarktes in der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Regulierung des Mietwohnungsmarktes in der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-religionspaedagogische-vertretbarkeit-der-biblischen-vaterfigur-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820458565-zum-problem-der-gottesdarstellung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820458565.jpg?v=1767770803</image:loc>
      <image:title>Die religionspaedagogische Vertretbarkeit der biblischen Vaterfigur</image:title>
      <image:caption>Book cover of: Die religionspaedagogische Vertretbarkeit der biblischen Vaterfigur</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regulierung-und-die-strategische-neupositionierung-der-freimakler-peter-lang-ag-9783631325155-patricia-menche</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631325155.jpg?v=1767770798</image:loc>
      <image:title>Die Regulierung Und Die Strategische Neupositionierung Der Freimakler</image:title>
      <image:caption>Book cover of: Die Regulierung Und Die Strategische Neupositionierung Der Freimakler. By: Patricia Menche</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rekonstruktion-des-baltischen-grundwortschatzes-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820479270</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820479270.jpg?v=1767770799</image:loc>
      <image:title>Die Rekonstruktion des baltischen Grundwortschatzes</image:title>
      <image:caption>Book cover of: Die Rekonstruktion des baltischen Grundwortschatzes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-relativitaet-des-gewerkschaftsbegriffs-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820460803-ein-beitrag-zur-einordnung-der-sozialen-maechtigkeit-im-kollektiven-arbeitsrecht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820460803.jpg?v=1767770798</image:loc>
      <image:title>Die Relativitaet des Gewerkschaftsbegriffs</image:title>
      <image:caption>Book cover of: Die Relativitaet des Gewerkschaftsbegriffs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reichsunmittelbaren-evangelischen-damenstifte-im-alten-reich-und-ihr-ende-peter-lang-ag-9783631305317-eine-vergleichende-untersuchung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631305317.jpg?v=1767770798</image:loc>
      <image:title>Die Reichsunmittelbaren Evangelischen Damenstifte Im Alten Reich Und Ihr Ende</image:title>
      <image:caption>Book cover of: Die Reichsunmittelbaren Evangelischen Damenstifte Im Alten Reich Und Ihr Ende</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sustainable-development-taylor-francis-ltd-9781138237698-what-was-achieved-in-the-desd-roger-firth</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138237698.jpg?v=1767770799</image:loc>
      <image:title>Education for Sustainable Development</image:title>
      <image:caption>Book cover of: Education for Sustainable Development. By: Roger Firth</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regulierung-der-rechnungslegung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631446300-eine-systematische-darstellung-der-grundlagen-mit-einer-anwendung-auf-die-frage-der-publizitaet</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631446300.jpg?v=1767770799</image:loc>
      <image:title>Die Regulierung der Rechnungslegung</image:title>
      <image:caption>Book cover of: Die Regulierung der Rechnungslegung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-peace-rle-edu-k-taylor-francis-ltd-9780415697972-herbert-read-undifferentiated</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415697972.jpg?v=1767770800</image:loc>
      <image:title>Education for Peace (RLE Edu K)</image:title>
      <image:caption>Book cover of: Education for Peace (RLE Edu K). By: Herbert Read - undifferentiated</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-public-democracy-state-university-of-new-york-press-9780791431689</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regionale-wirtschaftsentwicklung-in-suedkorea-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631473788-eine-empirische-untersuchung-mit-hilfe-der-shift-analyse</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631473788.jpg?v=1767770799</image:loc>
      <image:title>Die regionale Wirtschaftsentwicklung in Suedkorea</image:title>
      <image:caption>Book cover of: Die regionale Wirtschaftsentwicklung in Suedkorea</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-occupational-therapy-in-health-care-taylor-francis-inc-9780789016874-strategies-for-the-new-millennium</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789016874.jpg?v=1767770799</image:loc>
      <image:title>Education for Occupational Therapy in Health Care</image:title>
      <image:caption>Book cover of: Education for Occupational Therapy in Health Care</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sustainability-taylor-francis-ltd-9780415698719-becoming-naturally-smart-paul-clarke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415698719.jpg?v=1767770799</image:loc>
      <image:title>Education for Sustainability</image:title>
      <image:caption>Book cover of: Education for Sustainability. By: Paul Clarke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-peace-rle-edu-k-taylor-francis-ltd-9781138007574-herbert-read-undifferentiated</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138007574.jpg?v=1767770800</image:loc>
      <image:title>Education for Peace (RLE Edu K)</image:title>
      <image:caption>Book cover of: Education for Peace (RLE Edu K). By: Herbert Read - undifferentiated</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-library-cataloging-taylor-francis-inc-9780789031129-international-perspectives</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789031129.jpg?v=1767770800</image:loc>
      <image:title>Education for Library Cataloging</image:title>
      <image:caption>Book cover of: Education for Library Cataloging</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-life-liberty-fund-inc-9780865976214-correspondence-writings-on-religion-practical-philosophy-george-turnbull</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780865976214.jpg?v=1767770801</image:loc>
      <image:title>Education for Life</image:title>
      <image:caption>Book cover of: Education for Life. By: George Turnbull</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regionalwirtschaftliche-bewertung-von-oberflaechennahen-lagerstaetten-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631421925</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631421925.jpg?v=1767770800</image:loc>
      <image:title>Die regionalwirtschaftliche Bewertung von oberflaechennahen Lagerstaetten</image:title>
      <image:caption>Book cover of: Die regionalwirtschaftliche Bewertung von oberflaechennahen Lagerstaetten</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sale-taylor-francis-ltd-9780415677066-eric-c-midwinter</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415677066.jpg?v=1767770800</image:loc>
      <image:title>Education for Sale</image:title>
      <image:caption>Book cover of: Education for Sale. By: Eric C. Midwinter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regel-falsa-demonstratio-non-nocet-unter-besonderer-beruecksichtigung-der-testamentsauslegung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820400618</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820400618.jpg?v=1767770800</image:loc>
      <image:title>Die Regel «falsa demonstratio non nocet» - unter besonderer Beruecksichtigung der Testamentsauslegung</image:title>
      <image:caption>Book cover of: Die Regel «falsa demonstratio non nocet» - unter besonderer Beruecksichtigung der Testamentsauslegung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sale-taylor-francis-ltd-9780415750479-eric-c-midwinter</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415750479.jpg?v=1767770801</image:loc>
      <image:title>Education for Sale</image:title>
      <image:caption>Book cover of: Education for Sale. By: Eric C. Midwinter</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regionalpolitische-bedeutung-industrieller-verbundsysteme-und-die-beeinflussung-der-standortentscheidung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820465112-dargestellt-am-beispiel-suedwestdeutschland</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820465112.jpg?v=1767770801</image:loc>
      <image:title>Die regionalpolitische Bedeutung industrieller Verbundsysteme und die Beeinflussung der Standortentscheidung</image:title>
      <image:caption>Book cover of: Die regionalpolitische Bedeutung industrieller Verbundsysteme und die Beeinflussung der Standortentscheidung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regelungsabrede-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631486245-eine-zulaessige-und-zweckmaeige-kooperationsform-zur-loesung-kollektivrechtlicher-ordnungsprobleme-im-rahmen-der-paritaetischen-mitbestimmung-nach-87-abs-1-betrvg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631486245.jpg?v=1767770799</image:loc>
      <image:title>Die Regelungsabrede</image:title>
      <image:caption>Book cover of: Die Regelungsabrede</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regionale-konfiguration-weltgesellschaftlicher-konfliktformationen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820482034-am-beispiel-des-arabisch-persischen-golfes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820482034.jpg?v=1767770803</image:loc>
      <image:title>Die regionale Konfiguration weltgesellschaftlicher Konfliktformationen</image:title>
      <image:caption>Book cover of: Die regionale Konfiguration weltgesellschaftlicher Konfliktformationen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regionalpolitik-der-europaeischen-gemeinschaft-peter-lang-ag-9783631435069-unter-besonderer-beruecksichtigung-integrationstheoretischer-ueberlegungen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631435069.jpg?v=1767770803</image:loc>
      <image:title>Die Regionalpolitik Der Europaeischen Gemeinschaft</image:title>
      <image:caption>Book cover of: Die Regionalpolitik Der Europaeischen Gemeinschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-purposeful-teaching-around-the-world-taylor-francis-inc-9780815392064-kirsi-tirri</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815392064.jpg?v=1767770799</image:loc>
      <image:title>Education for Purposeful Teaching Around the World</image:title>
      <image:caption>Book cover of: Education for Purposeful Teaching Around the World. By: Kirsi Tirri</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reisevertragliche-gewaehrleistung-in-deutschland-england-und-frankreich-und-die-auswirkungen-der-eg-pauschalreiserichtlinie-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631454527</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631454527.jpg?v=1767770798</image:loc>
      <image:title>Die reisevertragliche Gewaehrleistung in Deutschland, England und Frankreich und die Auswirkungen der EG-Pauschalreiserichtlinie</image:title>
      <image:caption>Book cover of: Die reisevertragliche Gewaehrleistung in Deutschland, England und Frankreich und die Auswirkungen der EG-Pauschalreiserichtlinie</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sustainable-development-taylor-francis-ltd-9780415590846-papers-in-honour-of-the-united-nations-decade-of-education-for-sustainable-development-2005-2014-brian-chalkley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415590846.jpg?v=1767770799</image:loc>
      <image:title>Education for Sustainable Development</image:title>
      <image:caption>Book cover of: Education for Sustainable Development. By: Brian Chalkley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sustainability-taylor-francis-ltd-9781138150652-john-huckle</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138150652.jpg?v=1767770799</image:loc>
      <image:title>Education for Sustainability</image:title>
      <image:caption>Book cover of: Education for Sustainability. By: John Huckle</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-patients-and-clients-taylor-francis-ltd-9780415148498-vivien-coates</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415148498.jpg?v=1767770801</image:loc>
      <image:title>Education For Patients and Clients</image:title>
      <image:caption>Book cover of: Education For Patients and Clients. By: Vivien Coates</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regelung-des-betrugs-im-iberoamerikanischen-strafrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820460780</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820460780.jpg?v=1767770801</image:loc>
      <image:title>Die Regelung des Betrugs im iberoamerikanischen Strafrecht</image:title>
      <image:caption>Book cover of: Die Regelung des Betrugs im iberoamerikanischen Strafrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regulierung-der-deutschen-effektenboersen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631491041-eine-analyse-staatlicher-manahmen-im-deutschen-boersenwesen-seit-der-waehrungsreform</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631491041.jpg?v=1767770800</image:loc>
      <image:title>Die Regulierung der deutschen Effektenboersen</image:title>
      <image:caption>Book cover of: Die Regulierung der deutschen Effektenboersen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reformprogramme-fuer-die-heimerziehung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820463323-chancen-fuer-eine-demokratisierung-der-oeffentlichen-erziehung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820463323.jpg?v=1767770799</image:loc>
      <image:title>Die Reformprogramme fuer die Heimerziehung</image:title>
      <image:caption>Book cover of: Die Reformprogramme fuer die Heimerziehung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-occupational-therapy-in-health-care-taylor-francis-inc-9780789016867-strategies-for-the-new-millennium</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789016867.jpg?v=1767770800</image:loc>
      <image:title>Education for Occupational Therapy in Health Care</image:title>
      <image:caption>Book cover of: Education for Occupational Therapy in Health Care</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reformfaehigkeit-von-staat-und-gesellschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631319642-festschrift-fuer-klaus-lompe-zum-60-geburtstag</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631319642.jpg?v=1767770800</image:loc>
      <image:title>Die Reformfaehigkeit von Staat und Gesellschaft</image:title>
      <image:caption>Book cover of: Die Reformfaehigkeit von Staat und Gesellschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regionalisierung-der-schulreform-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631481561-der-tendenzwandel-in-der-schuldiskussion-nach-dem-scheitern-der-gesamtstaatlichen-bildungsreform</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631481561.jpg?v=1767770799</image:loc>
      <image:title>Die Regionalisierung der Schulreform</image:title>
      <image:caption>Book cover of: Die Regionalisierung der Schulreform</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-leadership-taylor-francis-ltd-9780415611695-the-international-administrative-staff-colleges-1948-1984-a-t-cornwall-jones</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415611695.jpg?v=1767770799</image:loc>
      <image:title>Education For Leadership</image:title>
      <image:caption>Book cover of: Education For Leadership. By: A. T. cornwall-jones</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reformpaedagogische-bewegung-griechenlands-zwischen-traditionalismus-und-modernisierung-1902-1920-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820464368</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820464368.jpg?v=1767770802</image:loc>
      <image:title>Die Reformpaedagogische Bewegung Griechenlands zwischen Traditionalismus und Modernisierung (1902-1920)</image:title>
      <image:caption>Book cover of: Die Reformpaedagogische Bewegung Griechenlands zwischen Traditionalismus und Modernisierung (1902-1920)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-leadership-taylor-francis-ltd-9780415432115-the-international-administrative-staff-colleges-1948-1984-cornwall-jones</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415432115.jpg?v=1767770801</image:loc>
      <image:title>Education For Leadership</image:title>
      <image:caption>Book cover of: Education For Leadership. By: Cornwall-Jones</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regenwalder-westafrikas-birkhauser-basel-9783034861496-okologie-bedrohung-und-schutz-martin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783034861496.jpg?v=1767770804</image:loc>
      <image:title>Die Regenwalder Westafrikas</image:title>
      <image:caption>Book cover of: Die Regenwalder Westafrikas. By: MARTIN</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-life-liberty-fund-inc-9780865976221-correspondence-writings-on-religion-practical-philosophy-george-turnbull</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780865976221.jpg?v=1767770801</image:loc>
      <image:title>Education for Life</image:title>
      <image:caption>Book cover of: Education for Life. By: George Turnbull</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-inclusive-citizenship-taylor-francis-ltd-9780415423670-dina-jane-kiwan-dina-kiwan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415423670.jpg?v=1767770800</image:loc>
      <image:title>Education for Inclusive Citizenship</image:title>
      <image:caption>Book cover of: Education for Inclusive Citizenship. By: Dina Jane Kiwan, Dina Kiwan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reformation-als-revolution-und-aufruhr-peter-lang-ag-9783631433560</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631433560.jpg?v=1767770800</image:loc>
      <image:title>Die Reformation ALS Revolution Und Aufruhr</image:title>
      <image:caption>Book cover of: Die Reformation ALS Revolution Und Aufruhr</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-empire-university-of-california-press-9780520285675-american-schools-race-and-the-paths-of-good-citizenship-clif-stratton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780520285675.jpg?v=1767770801</image:loc>
      <image:title>Education for Empire</image:title>
      <image:caption>Book cover of: Education for Empire. By: Clif Stratton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reichweite-formularmaeiger-sicherungsabreden-bei-buergschaft-und-grundschuld-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631445310</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631445310.jpg?v=1767770801</image:loc>
      <image:title>Die Reichweite formularmaeiger Sicherungsabreden bei Buergschaft und Grundschuld</image:title>
      <image:caption>Book cover of: Die Reichweite formularmaeiger Sicherungsabreden bei Buergschaft und Grundschuld</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sustainable-development-taylor-francis-ltd-9780415460057-papers-in-honour-of-the-united-nations-decade-of-education-for-sustainable-development-2005-2014-brian-chalkley</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415460057.jpg?v=1767770800</image:loc>
      <image:title>Education for Sustainable Development</image:title>
      <image:caption>Book cover of: Education for Sustainable Development. By: Brian Chalkley</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-liberation-the-university-of-alabama-press-9780817358488-the-american-missionary-association-and-african-americans-1890-to-the-civil-rights-movement-joe-m-richardson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780817358488.jpg?v=1767770802</image:loc>
      <image:title>Education for Liberation</image:title>
      <image:caption>Book cover of: Education for Liberation. By: Joe M. Richardson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-religioese-kritik-am-kopernikanischen-weltbild-in-griechenland-zwischen-1794-und-1821-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631458464-aspekte-griechisch-orthodoxer-apologetik-angesichts-naturwissenschaftlicher-fortschritte</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631458464.jpg?v=1767770803</image:loc>
      <image:title>Die religioese Kritik am kopernikanischen Weltbild in Griechenland zwischen 1794 und 1821</image:title>
      <image:caption>Book cover of: Die religioese Kritik am kopernikanischen Weltbild in Griechenland zwischen 1794 und 1821</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reformbestrebungen-zum-genossenschaftsgesetz-in-der-fruehzeit-der-bundesrepublik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631362358-die-beratungen-der-sachverstaendigenkommission-zur-ueberpruefung-des-genossenschaftsrechts-1954-bi</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631362358.jpg?v=1767770801</image:loc>
      <image:title>Die Reformbestrebungen zum Genossenschaftsgesetz in der Fruehzeit der Bundesrepublik</image:title>
      <image:caption>Book cover of: Die Reformbestrebungen zum Genossenschaftsgesetz in der Fruehzeit der Bundesrepublik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reformen-des-rechts-der-gesellschaften-mit-beschraenkter-haftung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631480502-entwuerfe-stellungnahmen-und-diskussionen-vom-referentenentwurf-1969-bis-zur-gmbh-novelle-1980</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631480502.jpg?v=1767770799</image:loc>
      <image:title>Die Reformen des Rechts der Gesellschaften mit beschraenkter Haftung</image:title>
      <image:caption>Book cover of: Die Reformen des Rechts der Gesellschaften mit beschraenkter Haftung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regelung-entgeltpflichtiger-sprachmehrwertdienste-in-den-usa-und-deutschland-unter-besonderer-beruecksichtigung-des-verbraucherschutzes-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631326824</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631326824.jpg?v=1767770802</image:loc>
      <image:title>Die Regelung entgeltpflichtiger Sprachmehrwertdienste in den USA und Deutschland unter besonderer Beruecksichtigung des Verbraucherschutzes</image:title>
      <image:caption>Book cover of: Die Regelung entgeltpflichtiger Sprachmehrwertdienste in den USA und Deutschland unter besonderer Beruecksichtigung des Verbraucherschutzes</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-democratic-citizenship-taylor-francis-ltd-9781138968332-a-challenge-for-multi-ethnic-societies-roberta-s-sigel</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138968332.jpg?v=1767770800</image:loc>
      <image:title>Education for Democratic Citizenship</image:title>
      <image:caption>Book cover of: Education for Democratic Citizenship. By: Roberta S. Sigel</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-leadership-and-social-responsibility-taylor-francis-ltd-9780750706087</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750706087.jpg?v=1767770802</image:loc>
      <image:title>Education for Leadership and Social Responsibility</image:title>
      <image:caption>Book cover of: Education for Leadership and Social Responsibility</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-sustainability-taylor-francis-ltd-9780415698726-becoming-naturally-smart-paul-clarke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415698726.jpg?v=1767770800</image:loc>
      <image:title>Education for Sustainability</image:title>
      <image:caption>Book cover of: Education for Sustainability. By: Paul Clarke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-citizenship-ideas-into-action-taylor-francis-ltd-9780415234313-a-practical-guide-for-teachers-of-pupils-aged-7-14-nick-clough</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415234313.jpg?v=1767770803</image:loc>
      <image:title>Education for Citizenship: Ideas into Action</image:title>
      <image:caption>Book cover of: Education for Citizenship: Ideas into Action. By: Nick Clough</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-library-cataloging-taylor-francis-inc-9780789031136-international-perspectives</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789031136.jpg?v=1767770801</image:loc>
      <image:title>Education for Library Cataloging</image:title>
      <image:caption>Book cover of: Education for Library Cataloging</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reform-des-rechts-der-handelsvertreter-von-1953-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631485934</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631485934.jpg?v=1767770805</image:loc>
      <image:title>Die Reform des Rechts der Handelsvertreter von 1953</image:title>
      <image:caption>Book cover of: Die Reform des Rechts der Handelsvertreter von 1953</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-judgment-harvard-business-review-press-9780875843650-the-artistry-of-discussion-leadership-c-roland-christensen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780875843650.jpg?v=1767770801</image:loc>
      <image:title>Education for Judgment</image:title>
      <image:caption>Book cover of: Education for Judgment. By: C. Roland Christensen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-regelung-des-371-abs-4-der-abgabenordung-1977-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631471609</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631471609.jpg?v=1767770803</image:loc>
      <image:title>Die Regelung des  371 Abs. 4 der Abgabenordung 1977</image:title>
      <image:caption>Book cover of: Die Regelung des  371 Abs. 4 der Abgabenordung 1977</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reformation-1517-vandenhoeck-ruprecht-gmbh-co-kg-9783525564813-zwischen-gewinn-und-verlust-cezary-lipinski</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783525564813.jpg?v=1767770801</image:loc>
      <image:title>Die Reformation 1517</image:title>
      <image:caption>Book cover of: Die Reformation 1517. By: Cezary Lipinski</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-human-flourishing-a-christian-perspective-intervarsity-press-9780830828128-paul-d-spears</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780830828128.jpg?v=1767770800</image:loc>
      <image:title>Education for Human Flourishing – A Christian Perspective</image:title>
      <image:caption>Book cover of: Education for Human Flourishing – A Christian Perspective. By: Paul D. Spears</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-democratic-citizenship-taylor-francis-ltd-9780754639596-issues-of-theory-and-practice</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780754639596.jpg?v=1767770803</image:loc>
      <image:title>Education for Democratic Citizenship</image:title>
      <image:caption>Book cover of: Education for Democratic Citizenship</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reform-des-bildungswesens-im-ost-west-dialog-peter-lang-ag-9783631328583-geschichte-aufgaben-probleme</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631328583.jpg?v=1767770801</image:loc>
      <image:title>Die Reform Des Bildungswesens Im Ost-West-Dialog</image:title>
      <image:caption>Book cover of: Die Reform Des Bildungswesens Im Ost-West-Dialog</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reform-der-erbenhaftung-im-erbrechtsausschu-der-akademie-fuer-deutsches-recht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631453254-eine-rechtsgeschichtliche-und-rechtsvergleichende-untersuchung-zu-einer-nie-verwirklichten-reform-dar</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631453254.jpg?v=1767770800</image:loc>
      <image:title>Die Reform der Erbenhaftung im Erbrechtsausschu der Akademie fuer Deutsches Recht</image:title>
      <image:caption>Book cover of: Die Reform der Erbenhaftung im Erbrechtsausschu der Akademie fuer Deutsches Recht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-patients-and-clients-taylor-francis-ltd-9780415148504-vivien-coates</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415148504.jpg?v=1767770801</image:loc>
      <image:title>Education For Patients and Clients</image:title>
      <image:caption>Book cover of: Education For Patients and Clients. By: Vivien Coates</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-citizenship-ideas-into-action-taylor-francis-ltd-9781138180857-a-practical-guide-for-teachers-of-pupils-aged-7-14-nick-clough</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138180857.jpg?v=1767770803</image:loc>
      <image:title>Education for Citizenship: Ideas into Action</image:title>
      <image:caption>Book cover of: Education for Citizenship: Ideas into Action. By: Nick Clough</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reform-des-spanischen-finanzausgleichs-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631498392-historische-bedingungen-theoretische-erfordernisse-europapolitische-konsequenzen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631498392.jpg?v=1767770805</image:loc>
      <image:title>Die Reform des spanischen Finanzausgleichs</image:title>
      <image:caption>Book cover of: Die Reform des spanischen Finanzausgleichs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reform-der-tschechischen-strafproze-ordnung-nach-1989-peter-lang-ag-9783631393727-im-spannungsfeld-von-rechtsstaatlichkeit-verfahrensoekonomie-und-effizienz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631393727.jpg?v=1767770804</image:loc>
      <image:title>Die Reform Der Tschechischen Strafprozeßordnung Nach 1989</image:title>
      <image:caption>Book cover of: Die Reform Der Tschechischen Strafprozeßordnung Nach 1989</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reichweite-der-registerrechtlichen-gruendungspruefung-einer-ag-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631336380-eine-untersuchung-unter-rechtsvergleichendem-aspekt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631336380.jpg?v=1767770804</image:loc>
      <image:title>Die Reichweite der registerrechtlichen Gruendungspruefung einer AG</image:title>
      <image:caption>Book cover of: Die Reichweite der registerrechtlichen Gruendungspruefung einer AG</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reform-des-us-exportkontrollrechts-peter-lang-ag-9783631336335-eine-rechtsvergleichende-untersuchung-unter-beruecksichtigung-der-internationalen-amerikanischen-europaeischen-und-kanadischen-rechtsentwicklung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631336335.jpg?v=1767770801</image:loc>
      <image:title>Die Reform Des Us-Exportkontrollrechts</image:title>
      <image:caption>Book cover of: Die Reform Des Us-Exportkontrollrechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-decline-university-of-toronto-press-9780802080349-soviet-vocational-and-technical-schooling-from-khrushchev-to-gorbachev</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780802080349.jpg?v=1767770802</image:loc>
      <image:title>Education for Decline</image:title>
      <image:caption>Book cover of: Education for Decline</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-empire-university-of-california-press-9780520285668-american-schools-race-and-the-paths-of-good-citizenship-clif-stratton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780520285668.jpg?v=1767770802</image:loc>
      <image:title>Education for Empire</image:title>
      <image:caption>Book cover of: Education for Empire. By: Clif Stratton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reform-der-informationsrechte-des-strafverteidigers-im-ermittlungsverfahren-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631438121</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631438121.jpg?v=1767770804</image:loc>
      <image:title>Die Reform der Informationsrechte des Strafverteidigers im Ermittlungsverfahren</image:title>
      <image:caption>Book cover of: Die Reform der Informationsrechte des Strafverteidigers im Ermittlungsverfahren</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reform-des-jugendstrafvollzuges-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631459904-ein-analytischer-vergleich-bisheriger-gesetzentwuerfe-sowie-die-konzipierung-eines-eigenen-alternativentwurfes</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631459904.jpg?v=1767770802</image:loc>
      <image:title>Die Reform des Jugendstrafvollzuges</image:title>
      <image:caption>Book cover of: Die Reform des Jugendstrafvollzuges</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reform-des-deutschen-staatsangehoerigkeitsrechts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631352212-eine-analyse-und-bewertung-der-vorliegenden-gesetzesvorhaben</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631352212.jpg?v=1767770803</image:loc>
      <image:title>Die Reform des deutschen Staatsangehoerigkeitsrechts</image:title>
      <image:caption>Book cover of: Die Reform des deutschen Staatsangehoerigkeitsrechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtswahlvoraussetzungen-und-die-bestimmung-des-auf-internationale-schuldvertraege-anwendbaren-rechts-nach-den-allgemeinen-kollisionsregeln-des-us-amerikanischen-ucc-und-des-deutschen-rechts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820498158.jpg?v=1767770805</image:loc>
      <image:title>Die Rechtswahlvoraussetzungen und die Bestimmung des auf internationale Schuldvertraege anwendbaren Rechts nach den allgemeinen Kollisionsregeln des US-amerikanischen UCC und des deutschen Rechts</image:title>
      <image:caption>Book cover of: Die Rechtswahlvoraussetzungen und die Bestimmung des auf internationale Schuldvertraege anwendbaren Rechts nach den allgemeinen Kollisionsregeln des US-amerikanischen UCC und des deutschen Rechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-childbirth-and-parenthood-taylor-francis-inc-9780815398844-elizabeth-r-perkins</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815398844.jpg?v=1767770803</image:loc>
      <image:title>Education for Childbirth and Parenthood</image:title>
      <image:caption>Book cover of: Education for Childbirth and Parenthood. By: Elizabeth R. Perkins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rede-der-text-die-praesentation-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631329597</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631329597.jpg?v=1767770806</image:loc>
      <image:title>Die Rede - Der Text - Die Praesentation</image:title>
      <image:caption>Book cover of: Die Rede - Der Text - Die Praesentation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-civic-and-political-participation-taylor-francis-ltd-9780415524193-a-critical-approach</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415524193.jpg?v=1767770803</image:loc>
      <image:title>Education for Civic and Political Participation</image:title>
      <image:caption>Book cover of: Education for Civic and Political Participation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtswidrigkeit-der-taten-von-mauerschuetzen-im-lichte-von-art-103-ii-gg-unter-besonderer-beruecksichtigung-des-voelkerrechts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631498569-ein-beitrag-zum-problem-der-verfolgung-von-staatlich</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631498569.jpg?v=1767770804</image:loc>
      <image:title>Die Rechtswidrigkeit der Taten von «Mauerschuetzen» im Lichte von Art. 103 II GG unter besonderer Beruecksichtigung des Voelkerrechts</image:title>
      <image:caption>Book cover of: Die Rechtswidrigkeit der Taten von «Mauerschuetzen» im Lichte von Art. 103 II GG unter besonderer Beruecksichtigung des Voelkerrechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-des-samenspenders-bei-der-insemination-ivf-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631338032-susanne-marian</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631338032.jpg?v=1767770804</image:loc>
      <image:title>Die Rechtsstellung des Samenspenders bei der Insemination / IVF</image:title>
      <image:caption>Book cover of: Die Rechtsstellung des Samenspenders bei der Insemination / IVF. By: Susanne Marian</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-all-taylor-francis-ltd-9780415547215-the-future-of-education-and-training-for-14-19-year-olds</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415547215.jpg?v=1767770802</image:loc>
      <image:title>Education for All</image:title>
      <image:caption>Book cover of: Education for All</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reform-der-gemeindeverfassung-in-nordrhein-westfalen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631325643-eine-constituent-policy-im-kommunalpolitischen-netzwerk</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631325643.jpg?v=1767770804</image:loc>
      <image:title>Die Reform der Gemeindeverfassung in Nordrhein-Westfalen</image:title>
      <image:caption>Book cover of: Die Reform der Gemeindeverfassung in Nordrhein-Westfalen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rede-und-pressefreiheit-gemae-art-21-der-koreanischen-verfassung-im-vergleich-zur-meinungsfreiheit-gemae-art-5-gg-in-der-bundesrepublik-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631431252</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631431252.jpg?v=1767770807</image:loc>
      <image:title>Die Rede- und Pressefreiheit gemae Art. 21 der koreanischen Verfassung im Vergleich zur Meinungsfreiheit gemae Art. 5 GG in der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Rede- und Pressefreiheit gemae Art. 21 der koreanischen Verfassung im Vergleich zur Meinungsfreiheit gemae Art. 5 GG in der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-childbirth-and-parenthood-taylor-francis-inc-9780815399339-elizabeth-r-perkins</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815399339.jpg?v=1767770803</image:loc>
      <image:title>Education for Childbirth and Parenthood</image:title>
      <image:caption>Book cover of: Education for Childbirth and Parenthood. By: Elizabeth R. Perkins</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-cataloging-and-the-organization-of-information-taylor-francis-inc-9780789020291-pitfalls-and-the-pendulum-janet-swan-hill</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789020291.jpg?v=1767770802</image:loc>
      <image:title>Education for Cataloging and the Organization of Information</image:title>
      <image:caption>Book cover of: Education for Cataloging and the Organization of Information. By: Janet Swan Hill</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-adults-taylor-francis-ltd-9780415750752-volume-1-adult-learning-and-education-malcolm-tight</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415750752.jpg?v=1767770802</image:loc>
      <image:title>Education for Adults</image:title>
      <image:caption>Book cover of: Education for Adults. By: Malcolm Tight</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-adults-taylor-francis-ltd-9781138006416-volume-2-opportunities-for-adult-education-malcolm-tight</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138006416.jpg?v=1767770801</image:loc>
      <image:title>Education for Adults</image:title>
      <image:caption>Book cover of: Education for Adults. By: Malcolm Tight</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-democratic-citizenship-taylor-francis-inc-9780805807257-a-challenge-for-multi-ethnic-societies</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805807257.jpg?v=1767770801</image:loc>
      <image:title>Education for Democratic Citizenship</image:title>
      <image:caption>Book cover of: Education for Democratic Citizenship</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-des-verbrechensopfers-im-staatlichen-strafverfahren-am-beispiel-der-nebenklage-peter-lang-ag-9783631558973-kai-yuan-wu</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631558973.jpg?v=1767770803</image:loc>
      <image:title>Die Rechtsstellung Des Verbrechensopfers Im Staatlichen Strafverfahren Am Beispiel Der Nebenklage</image:title>
      <image:caption>Book cover of: Die Rechtsstellung Des Verbrechensopfers Im Staatlichen Strafverfahren Am Beispiel Der Nebenklage. By: Kai-Yuan Wu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-parteiloser-kandidaten-und-mandatstraeger-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820471175</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820471175.jpg?v=1767770807</image:loc>
      <image:title>Die Rechtsstellung parteiloser Kandidaten und Mandatstraeger</image:title>
      <image:caption>Book cover of: Die Rechtsstellung parteiloser Kandidaten und Mandatstraeger</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-cataloging-and-the-organization-of-information-taylor-francis-inc-9780789020284-pitfalls-and-the-pendulum-janet-swan-hill</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789020284.jpg?v=1767770804</image:loc>
      <image:title>Education for Cataloging and the Organization of Information</image:title>
      <image:caption>Book cover of: Education for Cataloging and the Organization of Information. By: Janet Swan Hill</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-citizenship-bloomsbury-publishing-plc-9780847683666-ideas-and-innovations-in-political-learning</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780847683666.jpg?v=1767770802</image:loc>
      <image:title>Education for Citizenship</image:title>
      <image:caption>Book cover of: Education for Citizenship</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-des-reisenden-nach-inkrafttreten-der-reisevertragsnormen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820475821</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820475821.jpg?v=1767770804</image:loc>
      <image:title>Die Rechtsstellung des Reisenden nach Inkrafttreten der Reisevertragsnormen</image:title>
      <image:caption>Book cover of: Die Rechtsstellung des Reisenden nach Inkrafttreten der Reisevertragsnormen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtswahl-im-internationalen-erbrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631339312-unter-besonderer-beruecksichtigung-des-italienischen-ipr-reformgesetzes-n-218-vom-31-mai-1995-karin-dreher</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631339312.jpg?v=1767770805</image:loc>
      <image:title>Die Rechtswahl im internationalen Erbrecht</image:title>
      <image:caption>Book cover of: Die Rechtswahl im internationalen Erbrecht. By: Karin Dreher</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-flashpoints-taylor-francis-ltd-9780415743853-fighting-for-america-s-schools-alan-j-singer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415743853.jpg?v=1767770805</image:loc>
      <image:title>Education Flashpoints</image:title>
      <image:caption>Book cover of: Education Flashpoints. By: Alan J. Singer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-adults-taylor-francis-ltd-9780415685153-volume-1-adult-learning-and-education-malcolm-tight</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415685153.jpg?v=1767770803</image:loc>
      <image:title>Education for Adults</image:title>
      <image:caption>Book cover of: Education for Adults. By: Malcolm Tight</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-a-change-taylor-francis-ltd-9780415334853-transforming-the-way-we-teach-our-children-titus-alexander</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415334853.jpg?v=1767770803</image:loc>
      <image:title>Education for a Change</image:title>
      <image:caption>Book cover of: Education for a Change. By: Titus Alexander</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-des-erbrechtlichen-anwaerters-vor-und-nach-dem-erbfall-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631450024</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631450024.jpg?v=1767770805</image:loc>
      <image:title>Die Rechtsstellung des erbrechtlichen Anwaerters vor und nach dem Erbfall</image:title>
      <image:caption>Book cover of: Die Rechtsstellung des erbrechtlichen Anwaerters vor und nach dem Erbfall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-adolescents-anthroposophic-press-inc-9780880104050</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780880104050.jpg?v=1767770805</image:loc>
      <image:title>Education for Adolescents</image:title>
      <image:caption>Book cover of: Education for Adolescents</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-a-new-society-rle-edu-l-sociology-of-education-taylor-francis-ltd-9780415752787-ernest-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415752787.jpg?v=1767770806</image:loc>
      <image:title>Education For A New Society (RLE Edu L Sociology of Education)</image:title>
      <image:caption>Book cover of: Education For A New Society (RLE Edu L Sociology of Education). By: Ernest Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-adults-taylor-francis-ltd-9780415685177-volume-2-opportunities-for-adult-education-malcolm-tight</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415685177.jpg?v=1767770803</image:loc>
      <image:title>Education for Adults</image:title>
      <image:caption>Book cover of: Education for Adults. By: Malcolm Tight</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-des-schiffshypothekenglaeubigers-im-versicherungsfall-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631345214</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631345214.jpg?v=1767770806</image:loc>
      <image:title>Die Rechtsstellung des Schiffshypothekenglaeubigers im Versicherungsfall</image:title>
      <image:caption>Book cover of: Die Rechtsstellung des Schiffshypothekenglaeubigers im Versicherungsfall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-flashpoints-taylor-francis-ltd-9780415743846-fighting-for-america-s-schools-alan-j-singer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415743846.jpg?v=1767770804</image:loc>
      <image:title>Education Flashpoints</image:title>
      <image:caption>Book cover of: Education Flashpoints. By: Alan J. Singer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-facility-security-handbook-government-institutes-9780865871670-philpott-don</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780865871670.jpg?v=1767770805</image:loc>
      <image:title>Education Facility Security Handbook</image:title>
      <image:caption>Book cover of: Education Facility Security Handbook. By: Philpott Don</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-des-geschaeftsfuehrers-im-spanischen-aktienrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631441534-die-neuregelung-des-spanischen-aktienrechts-nach-dem-beitritt-spaniens-zur-eg</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631441534.jpg?v=1767770806</image:loc>
      <image:title>Die Rechtsstellung des Geschaeftsfuehrers im spanischen Aktienrecht</image:title>
      <image:caption>Book cover of: Die Rechtsstellung des Geschaeftsfuehrers im spanischen Aktienrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-documents-taylor-francis-ltd-9780415382878-england-and-wales-800-to-1972-d-w-sylvester</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415382878.jpg?v=1767770803</image:loc>
      <image:title>Education Documents</image:title>
      <image:caption>Book cover of: Education Documents. By: D.W. Sylvester</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-a-caring-society-teachers-college-press-9780807747186-classroom-relationships-and-moral-action-d-kay-johnston</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780807747186.jpg?v=1767770803</image:loc>
      <image:title>Education for a Caring Society</image:title>
      <image:caption>Book cover of: Education for a Caring Society. By: D. Kay Johnston</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-all-taylor-francis-ltd-9780415547222-the-future-of-education-and-training-for-14-19-year-olds</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415547222.jpg?v=1767770801</image:loc>
      <image:title>Education for All</image:title>
      <image:caption>Book cover of: Education for All</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-a-change-taylor-francis-ltd-9780415334846-transforming-the-way-we-teach-our-children-titus-alexander</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415334846.jpg?v=1767770805</image:loc>
      <image:title>Education for a Change</image:title>
      <image:caption>Book cover of: Education for a Change. By: Titus Alexander</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-der-vermittelten-lehrer-an-deutschen-schulen-im-ausland-aus-der-gesamtschau-des-auslandschulwesens-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631468913</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631468913.jpg?v=1767770803</image:loc>
      <image:title>Die Rechtsstellung der vermittelten Lehrer an deutschen Schulen im Ausland aus der Gesamtschau des Auslandschulwesens</image:title>
      <image:caption>Book cover of: Die Rechtsstellung der vermittelten Lehrer an deutschen Schulen im Ausland aus der Gesamtschau des Auslandschulwesens</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-der-verfahrensbeteiligten-im-gesellschaftsrechtlichen-spruchverfahren-peter-lang-ag-9783631549452-hendrik-mielke</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631549452.jpg?v=1767770804</image:loc>
      <image:title>Die Rechtsstellung Der Verfahrensbeteiligten Im Gesellschaftsrechtlichen Spruchverfahren</image:title>
      <image:caption>Book cover of: Die Rechtsstellung Der Verfahrensbeteiligten Im Gesellschaftsrechtlichen Spruchverfahren. By: Hendrik Mielke</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-des-anstoessers-an-oeffentlichen-gewaessern-peter-lang-international-academic-publishers-9783261013323</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261013323.jpg?v=1767770805</image:loc>
      <image:title>Die Rechtsstellung des Anstoessers an oeffentlichen Gewaessern</image:title>
      <image:caption>Book cover of: Die Rechtsstellung des Anstoessers an oeffentlichen Gewaessern</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-et-culture-dans-l-occident-medieval-taylor-francis-ltd-9780860783916</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780860783916.jpg?v=1767770804</image:loc>
      <image:title>Education et culture dans l’Occident medieval</image:title>
      <image:caption>Book cover of: Education et culture dans l’Occident medieval</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-a-new-society-rle-edu-l-sociology-of-education-taylor-francis-ltd-9780415500883-ernest-green</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415500883.jpg?v=1767770803</image:loc>
      <image:title>Education For A New Society (RLE Edu L Sociology of Education)</image:title>
      <image:caption>Book cover of: Education For A New Society (RLE Edu L Sociology of Education). By: Ernest Green</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-der-physiotherapeuten-peter-lang-ag-9783631372760-dae-shik-von-der-twer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631372760.jpg?v=1767770806</image:loc>
      <image:title>Die Rechtsstellung Der Physiotherapeuten</image:title>
      <image:caption>Book cover of: Die Rechtsstellung Der Physiotherapeuten. By: Dae Shik von der Twer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-des-vorsorgebeteiligten-destinataers-in-der-personalvorsorgestiftung-peter-lang-international-academic-publishers-9783261019035</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261019035.jpg?v=1767770805</image:loc>
      <image:title>Die Rechtsstellung des Vorsorgebeteiligten Destinataers in der Personalvorsorgestiftung</image:title>
      <image:caption>Book cover of: Die Rechtsstellung des Vorsorgebeteiligten Destinataers in der Personalvorsorgestiftung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-ecology-of-universities-taylor-francis-inc-9780815353652-integrating-learning-strategy-and-the-academy-robert-a-ellis</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815353652.jpg?v=1767770805</image:loc>
      <image:title>Education Ecology of Universities</image:title>
      <image:caption>Book cover of: Education Ecology of Universities. By: Robert A. Ellis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-ecology-of-universities-taylor-francis-inc-9780815353645-integrating-learning-strategy-and-the-academy-robert-a-ellis</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815353645.jpg?v=1767770803</image:loc>
      <image:title>Education Ecology of Universities</image:title>
      <image:caption>Book cover of: Education Ecology of Universities. By: Robert A. Ellis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-der-eingeborenen-voelker-in-den-usa-und-kanada-nach-nationalem-recht-und-voelkerrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631474785</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631474785.jpg?v=1767770804</image:loc>
      <image:title>Die Rechtsstellung der eingeborenen Voelker in den USA und Kanada nach nationalem Recht und Voelkerrecht</image:title>
      <image:caption>Book cover of: Die Rechtsstellung der eingeborenen Voelker in den USA und Kanada nach nationalem Recht und Voelkerrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-des-auszuliefernden-nach-tuerkischem-recht-unter-rechtsvergleichender-beruecksichtigung-des-deutschen-rechts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631455050</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631455050.jpg?v=1767770806</image:loc>
      <image:title>Die Rechtsstellung des Auszuliefernden nach tuerkischem Recht unter rechtsvergleichender Beruecksichtigung des deutschen Rechts</image:title>
      <image:caption>Book cover of: Die Rechtsstellung des Auszuliefernden nach tuerkischem Recht unter rechtsvergleichender Beruecksichtigung des deutschen Rechts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-der-ethnischen-minderheiten-in-der-bundesrepublik-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820401851</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820401851.jpg?v=1767770807</image:loc>
      <image:title>Die Rechtsstellung der ethnischen Minderheiten in der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Rechtsstellung der ethnischen Minderheiten in der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-der-in-der-schweiz-niedergelassenen-internationalen-organisationen-peter-lang-international-academic-publishers-9783261034236-le-statut-juridique-des-organisations-internationales-en-suisse-the-legal-status-of-international-organization</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261034236.jpg?v=1767770806</image:loc>
      <image:title>Die Rechtsstellung der in der Schweiz niedergelassenen internationalen Organisationen</image:title>
      <image:caption>Book cover of: Die Rechtsstellung der in der Schweiz niedergelassenen internationalen Organisationen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-der-gewerkschaften-in-der-schweiz-peter-lang-international-academic-publishers-9783261016225-mit-einem-kurzen-blick-auf-das-tuerkische-recht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261016225.jpg?v=1767770807</image:loc>
      <image:title>Die Rechtsstellung der Gewerkschaften in der Schweiz</image:title>
      <image:caption>Book cover of: Die Rechtsstellung der Gewerkschaften in der Schweiz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-der-enkel-ag-in-einer-mehrstufigen-unternehmensverbindung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631476444</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631476444.jpg?v=1767770805</image:loc>
      <image:title>Die Rechtsstellung der Enkel-AG in einer mehrstufigen Unternehmensverbindung</image:title>
      <image:caption>Book cover of: Die Rechtsstellung der Enkel-AG in einer mehrstufigen Unternehmensverbindung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-cultural-diversity-taylor-francis-ltd-9781138993334-convergence-and-divergence-volume-1-james-lynch</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138993334.jpg?v=1767770805</image:loc>
      <image:title>Education Cultural Diversity</image:title>
      <image:caption>Book cover of: Education Cultural Diversity. By: James Lynch</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-betroffener-bei-der-anwendung-auenhandelsrechtlicher-schutzinstrumente-in-den-vereinigten-staaten-und-der-europaeischen-gemeinschaft-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631427750-eine-vergleichende-untersuchung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631427750.jpg?v=1767770808</image:loc>
      <image:title>Die Rechtsstellung Betroffener bei der Anwendung auenhandelsrechtlicher Schutzinstrumente in den Vereinigten Staaten und der Europaeischen Gemeinschaft</image:title>
      <image:caption>Book cover of: Die Rechtsstellung Betroffener bei der Anwendung auenhandelsrechtlicher Schutzinstrumente in den Vereinigten Staaten und der Europaeischen Gemeinschaft</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsprognosepflicht-des-vertragsjuristen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631486085</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631486085.jpg?v=1767770806</image:loc>
      <image:title>Die Rechtsprognosepflicht des Vertragsjuristen</image:title>
      <image:caption>Book cover of: Die Rechtsprognosepflicht des Vertragsjuristen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-beyond-the-mesas-university-of-nebraska-press-9780803216266-hopi-students-at-sherman-institute-1902-1929-matthew-sakiestewa-gilbert</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780803216266.jpg?v=1767770805</image:loc>
      <image:title>Education Beyond the Mesas</image:title>
      <image:caption>Book cover of: Education Beyond the Mesas. By: Matthew Sakiestewa Gilbert</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-between-state-markets-and-civil-society-taylor-francis-ltd-9781138866768-comparative-perspectives-heinz-dieter-meyer</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138866768.jpg?v=1767770805</image:loc>
      <image:title>Education Between State, Markets, and Civil Society</image:title>
      <image:caption>Book cover of: Education Between State, Markets, and Civil Society. By: Heinz-Dieter Meyer</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-development-and-leadership-in-higher-education-taylor-francis-ltd-9780415335249-implementing-an-institutional-strategy-kym-fraser</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415335249.jpg?v=1767770805</image:loc>
      <image:title>Education Development and Leadership in Higher Education</image:title>
      <image:caption>Book cover of: Education Development and Leadership in Higher Education. By: Kym Fraser</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtssprache-in-den-sueddeutschen-stadtrechtsreformationen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631427057</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631427057.jpg?v=1767770809</image:loc>
      <image:title>Die Rechtssprache in den sueddeutschen Stadtrechtsreformationen</image:title>
      <image:caption>Book cover of: Die Rechtssprache in den sueddeutschen Stadtrechtsreformationen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-my-agenda-palgrave-usa-9780312295431-gertrude-williams-race-and-the-baltimore-public-schools-jo-ann-robinson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780312295431.jpg?v=1767770805</image:loc>
      <image:title>Education As My Agenda</image:title>
      <image:caption>Book cover of: Education As My Agenda. By: Jo Ann Robinson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-enforcement-taylor-francis-ltd-9780415876018-the-militarization-and-corporatization-of-schools-kenneth-j-saltman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415876018.jpg?v=1767770807</image:loc>
      <image:title>Education as Enforcement</image:title>
      <image:caption>Book cover of: Education as Enforcement. By: Kenneth J. Saltman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsprechung-zur-betriebsaufspaltung-unter-dem-blickwinkel-des-42-ao-1977-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631488409</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631488409.jpg?v=1767770808</image:loc>
      <image:title>Die Rechtsprechung zur Betriebsaufspaltung unter dem Blickwinkel des  42 AO 1977</image:title>
      <image:caption>Book cover of: Die Rechtsprechung zur Betriebsaufspaltung unter dem Blickwinkel des  42 AO 1977</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-a-multicultural-society-harvard-educational-review-u-s-9780916690519</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780916690519.jpg?v=1767770804</image:loc>
      <image:title>Education for a Multicultural Society</image:title>
      <image:caption>Book cover of: Education for a Multicultural Society</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-for-development-or-underdevelopment-wilfrid-laurier-university-press-9780889200852-guyana-s-educational-system-and-its-implications-for-the-third-world</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780889200852.jpg?v=1767770806</image:loc>
      <image:title>Education for Development or Underdevelopment?</image:title>
      <image:caption>Book cover of: Education for Development or Underdevelopment?</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsschutzmoeglichkeiten-der-tarifvertragsparteien-gegen-tarifwidrige-betriebsvereinbarungen-peter-lang-ag-9783631367124</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631367124.jpg?v=1767770809</image:loc>
      <image:title>Die Rechtsschutzmoeglichkeiten Der Tarifvertragsparteien Gegen Tarifwidrige Betriebsvereinbarungen</image:title>
      <image:caption>Book cover of: Die Rechtsschutzmoeglichkeiten Der Tarifvertragsparteien Gegen Tarifwidrige Betriebsvereinbarungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsprechung-des-europaeischen-gerichtshofs-zur-freizuegigkeit-und-gleichbehandlung-von-angehoerigen-der-eg-mitgliedstaaten-hinsichtlich-des-besuchs-von-ausbildungsstaetten-und-deren-auswirkung-fuer-die-bundesrepublik-deutschland-peter-lang-gmbh-int</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631440445.jpg?v=1767770806</image:loc>
      <image:title>Die Rechtsprechung des Europaeischen Gerichtshofs zur Freizuegigkeit und Gleichbehandlung von Angehoerigen der EG-Mitgliedstaaten hinsichtlich des Besuchs von Ausbildungsstaetten und deren Auswirkung fuer die Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Rechtsprechung des Europaeischen Gerichtshofs zur Freizuegigkeit und Gleichbehandlung von Angehoerigen der EG-Mitgliedstaaten hinsichtlich des Besuchs von Ausbildungsstaetten und deren Auswirkung fuer die Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsstellung-der-besonderen-vertreter-gem-147-aktg-peter-lang-ag-9783631348970</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631348970.jpg?v=1767770811</image:loc>
      <image:title>Die Rechtsstellung Der Besonderen Vertreter Gem. § 147 Aktg</image:title>
      <image:caption>Book cover of: Die Rechtsstellung Der Besonderen Vertreter Gem. § 147 Aktg</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-a-social-factor-rle-edu-l-sociology-of-education-taylor-francis-ltd-9780415504348-m-l-jacks</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415504348.jpg?v=1767770804</image:loc>
      <image:title>Education as a Social Factor (RLE Edu L Sociology of Education)</image:title>
      <image:caption>Book cover of: Education as a Social Factor (RLE Edu L Sociology of Education). By: M. L. Jacks</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-between-two-worlds-taylor-francis-inc-9780202308135-alexander-meiklejohn</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780202308135.jpg?v=1767770807</image:loc>
      <image:title>Education Between Two Worlds</image:title>
      <image:caption>Book cover of: Education Between Two Worlds. By: Alexander Meiklejohn</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsprechung-des-reichsgerichts-in-ehescheidungssachen-der-jahre-1900-bis-1905-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631309421</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631309421.jpg?v=1767770809</image:loc>
      <image:title>Die Rechtsprechung des Reichsgerichts in Ehescheidungssachen der Jahre 1900 bis 1905</image:title>
      <image:caption>Book cover of: Die Rechtsprechung des Reichsgerichts in Ehescheidungssachen der Jahre 1900 bis 1905</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsproblematik-der-wartezeiten-in-der-privatversicherung-unter-besonderer-beruecksichtigung-der-rechtsschutzversicherung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631404379</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631404379.jpg?v=1767770809</image:loc>
      <image:title>Die Rechtsproblematik der Wartezeiten in der Privatversicherung unter besonderer Beruecksichtigung der Rechtsschutzversicherung</image:title>
      <image:caption>Book cover of: Die Rechtsproblematik der Wartezeiten in der Privatversicherung unter besonderer Beruecksichtigung der Rechtsschutzversicherung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-at-the-edge-of-empire-university-of-washington-press-9780295999661-negotiating-pueblo-identity-in-new-mexico-s-indian-boarding-schools-john-r-gram</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780295999661.jpg?v=1767770806</image:loc>
      <image:title>Education at the Edge of Empire</image:title>
      <image:caption>Book cover of: Education at the Edge of Empire. By: John R. Gram</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-history-taylor-francis-ltd-9780415432863-harold-silver</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415432863.jpg?v=1767770807</image:loc>
      <image:title>Education as History</image:title>
      <image:caption>Book cover of: Education as History. By: Harold Silver</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsprechung-des-bundesverfassungsgerichts-zur-eigentumsgarantie-und-ihre-auswirkungen-auf-die-staatshaftung-fuer-legislatives-unrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631478417</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631478417.jpg?v=1767770809</image:loc>
      <image:title>Die Rechtsprechung des Bundesverfassungsgerichts zur Eigentumsgarantie und ihre Auswirkungen auf die Staatshaftung fuer legislatives Unrecht</image:title>
      <image:caption>Book cover of: Die Rechtsprechung des Bundesverfassungsgerichts zur Eigentumsgarantie und ihre Auswirkungen auf die Staatshaftung fuer legislatives Unrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsprechung-des-bundesverfassungsgerichts-und-des-bundesgerichtshofs-zum-bestimmtheitsgrundsatz-im-strafrecht-art-103-abs-2-gg-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820489361</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820489361.jpg?v=1767770807</image:loc>
      <image:title>Die Rechtsprechung des Bundesverfassungsgerichts und des Bundesgerichtshofs zum Bestimmtheitsgrundsatz im Strafrecht (Art. 103 Abs. 2 GG)</image:title>
      <image:caption>Book cover of: Die Rechtsprechung des Bundesverfassungsgerichts und des Bundesgerichtshofs zum Bestimmtheitsgrundsatz im Strafrecht (Art. 103 Abs. 2 GG)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsprechung-des-hanseatischen-oberlandesgerichts-zum-persoenlichen-eherecht-in-hamburgischen-gerichtsfaellen-von-1879-1900-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631498637</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631498637.jpg?v=1767770808</image:loc>
      <image:title>Die Rechtsprechung des Hanseatischen Oberlandesgerichts zum persoenlichen Eherecht in Hamburgischen Gerichtsfaellen von 1879-1900</image:title>
      <image:caption>Book cover of: Die Rechtsprechung des Hanseatischen Oberlandesgerichts zum persoenlichen Eherecht in Hamburgischen Gerichtsfaellen von 1879-1900</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-between-state-markets-and-civil-society-taylor-francis-inc-9780805831955-comparative-perspectives</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805831955.jpg?v=1767770806</image:loc>
      <image:title>Education Between State, Markets, and Civil Society</image:title>
      <image:caption>Book cover of: Education Between State, Markets, and Civil Society</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-humanisation-taylor-francis-ltd-9781138646360-dialogic-pedagogy-in-post-conflict-peacebuilding-scherto-gill</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138646360.jpg?v=1767770806</image:loc>
      <image:title>Education as Humanisation</image:title>
      <image:caption>Book cover of: Education as Humanisation. By: Scherto Gill</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsprechung-des-bundesverfassungsgerichts-und-der-landesverfassungsgerichte-zur-rechtsstellung-von-parlament-und-regierung-im-vergleich-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631371435-kay-dirk-lindemann</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631371435.jpg?v=1767770807</image:loc>
      <image:title>Die Rechtsprechung des Bundesverfassungsgerichts und der Landesverfassungsgerichte zur Rechtsstellung von Parlament und Regierung im Vergleich</image:title>
      <image:caption>Book cover of: Die Rechtsprechung des Bundesverfassungsgerichts und der Landesverfassungsgerichte zur Rechtsstellung von Parlament und Regierung im Vergleich. By: Kay-Dirk Lindemann</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsschutzmoeglichkeiten-der-ehegatten-in-unterhaltssachen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631484449</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631484449.jpg?v=1767770807</image:loc>
      <image:title>Die Rechtsschutzmoeglichkeiten der Ehegatten in Unterhaltssachen</image:title>
      <image:caption>Book cover of: Die Rechtsschutzmoeglichkeiten der Ehegatten in Unterhaltssachen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-freedom-bloomsbury-publishing-plc-9780739120699-african-american-educational-thought-and-activism-haroon-kharem</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780739120699.jpg?v=1767770806</image:loc>
      <image:title>Education as Freedom</image:title>
      <image:caption>Book cover of: Education as Freedom. By: Haroon Kharem</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-a-social-factor-rle-edu-l-sociology-of-education-taylor-francis-ltd-9780415752862-leonard-m-jacks</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415752862.jpg?v=1767770806</image:loc>
      <image:title>Education as a Social Factor (RLE Edu L Sociology of Education)</image:title>
      <image:caption>Book cover of: Education as a Social Factor (RLE Edu L Sociology of Education). By: Leonard M. Jacks</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtspositionen-der-organe-der-gmbh-und-des-betriebsrates-im-konkurs-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820414349</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820414349.jpg?v=1767770808</image:loc>
      <image:title>Die Rechtspositionen der Organe der GmbH und des Betriebsrates im Konkurs</image:title>
      <image:caption>Book cover of: Die Rechtspositionen der Organe der GmbH und des Betriebsrates im Konkurs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-between-speech-and-writing-taylor-francis-ltd-9780367367930-crossing-the-boundaries-of-dao-and-deconstruction-ruyu-hung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367367930.jpg?v=1767770809</image:loc>
      <image:title>Education between Speech and Writing</image:title>
      <image:caption>Book cover of: Education between Speech and Writing. By: Ruyu Hung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-women-in-the-early-modern-hispanic-world-taylor-francis-ltd-9780754660330-elizabeth-teresa-howe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780754660330.jpg?v=1767770806</image:loc>
      <image:title>Education and Women in the Early Modern Hispanic World</image:title>
      <image:caption>Book cover of: Education and Women in the Early Modern Hispanic World. By: Elizabeth Teresa Howe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-enforcement-taylor-francis-ltd-9780415875998-the-militarization-and-corporatization-of-schools-kenneth-j-saltman</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415875998.jpg?v=1767770805</image:loc>
      <image:title>Education as Enforcement</image:title>
      <image:caption>Book cover of: Education as Enforcement. By: Kenneth J. Saltman</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsprechung-des-reichsgerichts-zu-dem-scheidungsgrund-des-49-eheg-eheg-1938-in-den-jahren-1938-1945-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631348710-vesta-hoffmann-steudner</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631348710.jpg?v=1767770808</image:loc>
      <image:title>Die Rechtsprechung des Reichsgerichts zu dem Scheidungsgrund des  49 EheG (EheG 1938) in den Jahren 1938-1945</image:title>
      <image:caption>Book cover of: Die Rechtsprechung des Reichsgerichts zu dem Scheidungsgrund des  49 EheG (EheG 1938) in den Jahren 1938-1945. By: Vesta Hoffmann-Steudner</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsnatur-praesidialer-geschaeftsverteilungsplaene-gemae-21-e-gvg-und-der-rechtsschutz-des-richters-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631333105</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631333105.jpg?v=1767770808</image:loc>
      <image:title>Die Rechtsnatur praesidialer Geschaeftsverteilungsplaene gemae  21 e GVG und der Rechtsschutz des Richters</image:title>
      <image:caption>Book cover of: Die Rechtsnatur praesidialer Geschaeftsverteilungsplaene gemae  21 e GVG und der Rechtsschutz des Richters</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsprechung-der-gerichte-der-bundesrepublik-deutschland-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820488876-zum-voelkergewohnheitsrecht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820488876.jpg?v=1767770810</image:loc>
      <image:title>Die Rechtsprechung der Gerichte der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die Rechtsprechung der Gerichte der Bundesrepublik Deutschland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-history-taylor-francis-ltd-9780415761819-harold-silver</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415761819.jpg?v=1767770805</image:loc>
      <image:title>Education as History</image:title>
      <image:caption>Book cover of: Education as History. By: Harold Silver</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-and-for-legitimacy-wilfrid-laurier-university-press-9780889202313-developments-in-west-indian-education-between-1846-and-1895</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780889202313.jpg?v=1767770808</image:loc>
      <image:title>Education As and for Legitimacy</image:title>
      <image:caption>Book cover of: Education As and for Legitimacy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-a-force-for-social-change-anthroposophic-press-inc-9780880104111</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780880104111.jpg?v=1767770808</image:loc>
      <image:title>Education as a Force for Social Change</image:title>
      <image:caption>Book cover of: Education as a Force for Social Change</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-development-and-leadership-in-higher-education-taylor-francis-ltd-9780415349697-implementing-an-institutional-strategy-kym-fraser</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415349697.jpg?v=1767770808</image:loc>
      <image:title>Education Development and Leadership in Higher Education</image:title>
      <image:caption>Book cover of: Education Development and Leadership in Higher Education. By: Kym Fraser</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-training-statistics-for-the-united-kingdom-2005-renouf-pub-co-ltd-9780112711810</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsnatur-der-richtlinien-im-kassenarztrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820403091</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820403091.jpg?v=1767770811</image:loc>
      <image:title>Die Rechtsnatur der Richtlinien im Kassenarztrecht</image:title>
      <image:caption>Book cover of: Die Rechtsnatur der Richtlinien im Kassenarztrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsnatur-des-denkmalbereichs-und-seine-beruecksichtigung-im-bauplanungsrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631311233</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631311233.jpg?v=1767770808</image:loc>
      <image:title>Die Rechtsnatur des Denkmalbereichs und seine Beruecksichtigung im Bauplanungsrecht</image:title>
      <image:caption>Book cover of: Die Rechtsnatur des Denkmalbereichs und seine Beruecksichtigung im Bauplanungsrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-a-political-tool-in-asia-taylor-francis-ltd-9780415452595-marie-lall-edw</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415452595.jpg?v=1767770807</image:loc>
      <image:title>Education as a Political Tool in Asia</image:title>
      <image:caption>Book cover of: Education as a Political Tool in Asia. By: Marie Lall: Edw</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-work-in-great-britain-germany-and-italy-taylor-francis-ltd-9780415153331</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415153331.jpg?v=1767770808</image:loc>
      <image:title>Education and Work in Great Britain, Germany and Italy</image:title>
      <image:caption>Book cover of: Education and Work in Great Britain, Germany and Italy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-the-cultivation-of-intelligence-taylor-francis-inc-9780805832518-michael-e-martinez</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805832518.jpg?v=1767770808</image:loc>
      <image:title>Education As the Cultivation of Intelligence</image:title>
      <image:caption>Book cover of: Education As the Cultivation of Intelligence. By: Michael E. Martinez</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsnormenbildung-im-bereich-der-polizeilichen-informationsverwaltung-peter-lang-ag-9783631514894-michael-peters</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631514894.jpg?v=1767770808</image:loc>
      <image:title>Die Rechtsnormenbildung Im Bereich Der Polizeilichen Informationsverwaltung</image:title>
      <image:caption>Book cover of: Die Rechtsnormenbildung Im Bereich Der Polizeilichen Informationsverwaltung. By: Michael Peters</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-warfare-in-europe-taylor-francis-ltd-9780415791946-david-coulby</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415791946.jpg?v=1767770807</image:loc>
      <image:title>Education and Warfare in Europe</image:title>
      <image:caption>Book cover of: Education and Warfare in Europe. By: David Coulby</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-the-cultivation-of-intelligence-taylor-francis-ltd-9781138866782-michael-e-martinez</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138866782.jpg?v=1767770808</image:loc>
      <image:title>Education As the Cultivation of Intelligence</image:title>
      <image:caption>Book cover of: Education As the Cultivation of Intelligence. By: Michael E. Martinez</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsnatur-der-uebereinkommen-der-internationalen-arbeitsorganisation-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820412185-zugleich-ein-beitrag-zur-lehre-vom-soft-law</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820412185.jpg?v=1767770812</image:loc>
      <image:title>Die Rechtsnatur der Uebereinkommen der Internationalen Arbeitsorganisation</image:title>
      <image:caption>Book cover of: Die Rechtsnatur der Uebereinkommen der Internationalen Arbeitsorganisation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-training-in-geo-engineering-sciences-taylor-francis-ltd-9780415475938-soil-mechanics-and-geotechnical-engineering-engineering-geology-rock-mechanics</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415475938.jpg?v=1767770808</image:loc>
      <image:title>Education and Training in Geo-Engineering Sciences</image:title>
      <image:caption>Book cover of: Education and Training in Geo-Engineering Sciences</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-as-a-political-tool-in-asia-taylor-francis-ltd-9780415595360-marie-lall</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415595360.jpg?v=1767770808</image:loc>
      <image:title>Education as a Political Tool in Asia</image:title>
      <image:caption>Book cover of: Education as a Political Tool in Asia. By: Marie Lall</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-war-harvard-educational-review-u-s-9780916690496-elizabeth-e-blair</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780916690496.jpg?v=1767770809</image:loc>
      <image:title>Education and War</image:title>
      <image:caption>Book cover of: Education and War. By: Elizabeth E. Blair</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-training-in-solution-focused-brief-therapy-taylor-francis-inc-9780789029287</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789029287.jpg?v=1767770808</image:loc>
      <image:title>Education and Training in Solution-Focused Brief Therapy</image:title>
      <image:caption>Book cover of: Education and Training in Solution-Focused Brief Therapy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-training-for-development-in-east-asia-taylor-francis-ltd-9780415181266-the-political-economy-of-skill-formation-in-newly-industrialised-economies-david-ashton</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415181266.jpg?v=1767770808</image:loc>
      <image:title>Education and Training for Development in East Asia</image:title>
      <image:caption>Book cover of: Education and Training for Development in East Asia. By: David Ashton</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-training-in-solution-focused-brief-therapy-taylor-francis-inc-9780789029270</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780789029270.jpg?v=1767770808</image:loc>
      <image:title>Education and Training in Solution-Focused Brief Therapy</image:title>
      <image:caption>Book cover of: Education and Training in Solution-Focused Brief Therapy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-university-cambridge-university-press-9780521295734-a-sketch-for-an-english-school</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521295734.jpg?v=1767770808</image:loc>
      <image:title>Education and the University</image:title>
      <image:caption>Book cover of: Education and the University</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-working-class-rle-edu-l-sociology-of-education-taylor-francis-ltd-9780415752794-jackson-brian</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415752794.jpg?v=1767770808</image:loc>
      <image:title>Education and the Working Class (RLE Edu L Sociology of Education)</image:title>
      <image:caption>Book cover of: Education and the Working Class (RLE Edu L Sociology of Education). By: Jackson, Brian</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-theory-strangers-in-paradigms-open-university-press-9780335211791-thomas-gary-gary-l-thomas</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780335211791.jpg?v=1767770809</image:loc>
      <image:title>Education and Theory: Strangers in Paradigms</image:title>
      <image:caption>Book cover of: Education and Theory: Strangers in Paradigms. By: Thomas, Gary, Gary L. Thomas</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-state-taylor-francis-ltd-9781138777859-international-perspectives-on-a-changing-relationship-carla-aubry</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138777859.jpg?v=1767770808</image:loc>
      <image:title>Education and the State</image:title>
      <image:caption>Book cover of: Education and the State. By: Carla Aubry</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-women-in-the-early-modern-hispanic-world-taylor-francis-ltd-9781138278318-elizabeth-teresa-howe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138278318.jpg?v=1767770809</image:loc>
      <image:title>Education and Women in the Early Modern Hispanic World</image:title>
      <image:caption>Book cover of: Education and Women in the Early Modern Hispanic World. By: Elizabeth Teresa Howe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-youth-taylor-francis-ltd-9781138629820-david-marsland</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138629820.jpg?v=1767770807</image:loc>
      <image:title>Education and Youth</image:title>
      <image:caption>Book cover of: Education and Youth. By: David Marsland</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-urban-crisis-taylor-francis-ltd-9780415750462-frank-field</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415750462.jpg?v=1767770809</image:loc>
      <image:title>Education and the Urban Crisis</image:title>
      <image:caption>Book cover of: Education and the Urban Crisis. By: Frank Field</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-training-in-a-knowledge-based-economy-palgrave-macmillan-9780333919897</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780333919897.jpg?v=1767770808</image:loc>
      <image:title>Education and Training in a Knowledge-Based Economy</image:title>
      <image:caption>Book cover of: Education and Training in a Knowledge-Based Economy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-urban-crisis-taylor-francis-ltd-9780415676755-harold-entwistle</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415676755.jpg?v=1767770810</image:loc>
      <image:title>Education and the Urban Crisis</image:title>
      <image:caption>Book cover of: Education and the Urban Crisis. By: Harold Entwistle</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-struggle-for-democracy-open-university-press-9780335195206</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780335195206.jpg?v=1767770810</image:loc>
      <image:title>Education and the Struggle for Democracy</image:title>
      <image:caption>Book cover of: Education and the Struggle for Democracy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-state-taylor-francis-ltd-9781138290891-international-perspectives-on-a-changing-relationship-carla-aubry</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138290891.jpg?v=1767770813</image:loc>
      <image:title>Education and the State</image:title>
      <image:caption>Book cover of: Education and the State. By: Carla Aubry</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-training-in-japan-taylor-francis-ltd-9780415168427-thomas-rohlen</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415168427.jpg?v=1767770808</image:loc>
      <image:title>Education and Training in Japan</image:title>
      <image:caption>Book cover of: Education and Training in Japan. By: Thomas Rohlen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsnatur-des-boersenoptionsgeschaefts-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631431696-unter-besonderer-beruecksichtigung-des-inlaendischen-wertpapieroptionshandels</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631431696.jpg?v=1767770810</image:loc>
      <image:title>Die Rechtsnatur des Boersenoptionsgeschaefts</image:title>
      <image:caption>Book cover of: Die Rechtsnatur des Boersenoptionsgeschaefts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-value-of-knowledge-taylor-francis-ltd-9781138695122-m-a-b-degenhardt</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138695122.jpg?v=1767770809</image:loc>
      <image:title>Education and the Value of Knowledge</image:title>
      <image:caption>Book cover of: Education and the Value of Knowledge. By: M. A. B. Degenhardt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsfolgen-der-miachtung-der-betriebsverfassung-durch-den-arbeitgeber-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631436318</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631436318.jpg?v=1767770810</image:loc>
      <image:title>Die Rechtsfolgen der Miachtung der Betriebsverfassung durch den Arbeitgeber</image:title>
      <image:caption>Book cover of: Die Rechtsfolgen der Miachtung der Betriebsverfassung durch den Arbeitgeber</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsfolgen-der-nichtumsetzung-von-eg-richtlinien-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631322093-unter-besonderer-beruecksichtigung-der-staatshaftungs-sowie-der-normerlaklage</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631322093.jpg?v=1767770808</image:loc>
      <image:title>Die Rechtsfolgen der Nichtumsetzung von EG-Richtlinien</image:title>
      <image:caption>Book cover of: Die Rechtsfolgen der Nichtumsetzung von EG-Richtlinien</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsbeziehungen-des-ehemannes-zum-eingebrachten-gut-der-ehefrau-peter-lang-international-academic-publishers-9783261000712-hansj-rg-schnellmann</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261000712.jpg?v=1767770811</image:loc>
      <image:title>Die Rechtsbeziehungen des Ehemannes zum Eingebrachten Gut der Ehefrau</image:title>
      <image:caption>Book cover of: Die Rechtsbeziehungen des Ehemannes zum Eingebrachten Gut der Ehefrau. By: Hansjürg Schnellmann</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsgestaltung-des-kinderlastenausgleichs-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631479186-eine-systemuebergreifende-studie</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631479186.jpg?v=1767770808</image:loc>
      <image:title>Die Rechtsgestaltung des Kinderlastenausgleichs</image:title>
      <image:caption>Book cover of: Die Rechtsgestaltung des Kinderlastenausgleichs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-working-class-rle-edu-l-sociology-of-education-taylor-francis-ltd-9780415500906-jackson-brian</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415500906.jpg?v=1767770810</image:loc>
      <image:title>Education and the Working Class (RLE Edu L Sociology of Education)</image:title>
      <image:caption>Book cover of: Education and the Working Class (RLE Edu L Sociology of Education). By: Jackson, Brian</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-soul-state-university-of-new-york-press-9780791443422-toward-a-spiritual-curriculum-john-p-miller</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsfortbildung-durch-den-gerichtshof-der-europaeischen-gemeinschaften-und-die-rechtsstellung-der-mitgliedstaaten-der-europaeischen-union-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631361450-patrick-mittmann</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631361450.jpg?v=1767770810</image:loc>
      <image:title>Die Rechtsfortbildung durch den Gerichtshof der Europaeischen Gemeinschaften und die Rechtsstellung der Mitgliedstaaten der Europaeischen Union</image:title>
      <image:caption>Book cover of: Die Rechtsfortbildung durch den Gerichtshof der Europaeischen Gemeinschaften und die Rechtsstellung der Mitgliedstaaten der Europaeischen Union. By: Patrick Mittmann</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsfolgen-fehlerhafter-abfindungsklauseln-in-gmbh-gesellschaftsvertraegen-peter-lang-ag-9783631502891</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631502891.jpg?v=1767770811</image:loc>
      <image:title>Die Rechtsfolgen Fehlerhafter Abfindungsklauseln in Gmbh-Gesellschaftsvertraegen</image:title>
      <image:caption>Book cover of: Die Rechtsfolgen Fehlerhafter Abfindungsklauseln in Gmbh-Gesellschaftsvertraegen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsfolgen-mitbestimmungswidriger-manahmen-fuer-das-arbeitsverhaeltnis-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631333129-eine-zivilrechtsdogmatische-untersuchung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631333129.jpg?v=1767770808</image:loc>
      <image:title>Die Rechtsfolgen mitbestimmungswidriger Manahmen fuer das Arbeitsverhaeltnis</image:title>
      <image:caption>Book cover of: Die Rechtsfolgen mitbestimmungswidriger Manahmen fuer das Arbeitsverhaeltnis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-spirit-of-man-rle-edu-k-taylor-francis-ltd-9780415751285-francis-pollard</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415751285.jpg?v=1767770809</image:loc>
      <image:title>Education and the Spirit of Man (RLE Edu K)</image:title>
      <image:caption>Book cover of: Education and the Spirit of Man (RLE Edu K). By: Francis Pollard</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtslage-der-ddr-naturschutzgebiete-in-mecklenburg-vorpommern-nach-dem-einigungsvertrag-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631356173</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631356173.jpg?v=1767770811</image:loc>
      <image:title>Die Rechtslage der DDR-Naturschutzgebiete in Mecklenburg-Vorpommern nach dem Einigungsvertrag</image:title>
      <image:caption>Book cover of: Die Rechtslage der DDR-Naturschutzgebiete in Mecklenburg-Vorpommern nach dem Einigungsvertrag</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsbeziehungen-zwischen-versorgungsunternehmen-installateuren-und-kunden-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631493625</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631493625.jpg?v=1767770809</image:loc>
      <image:title>Die Rechtsbeziehungen zwischen Versorgungsunternehmen, Installateuren und Kunden</image:title>
      <image:caption>Book cover of: Die Rechtsbeziehungen zwischen Versorgungsunternehmen, Installateuren und Kunden</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsnatur-derivativer-finanzinstrumente-und-ihre-darstellung-im-jahresabschlu-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631365984</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631365984.jpg?v=1767770809</image:loc>
      <image:title>Die Rechtsnatur derivativer Finanzinstrumente und ihre Darstellung im Jahresabschlu</image:title>
      <image:caption>Book cover of: Die Rechtsnatur derivativer Finanzinstrumente und ihre Darstellung im Jahresabschlu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtlichen-anforderungen-an-die-kurtaxengesetzgebung-in-der-schweiz-peter-lang-international-academic-publishers-9783261015761</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261015761.jpg?v=1767770809</image:loc>
      <image:title>Die rechtlichen Anforderungen an die Kurtaxengesetzgebung in der Schweiz</image:title>
      <image:caption>Book cover of: Die rechtlichen Anforderungen an die Kurtaxengesetzgebung in der Schweiz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-spirit-of-man-rle-edu-k-taylor-francis-ltd-9780415697644-francis-pollard</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415697644.jpg?v=1767770813</image:loc>
      <image:title>Education and the Spirit of Man (RLE Edu K)</image:title>
      <image:caption>Book cover of: Education and the Spirit of Man (RLE Edu K). By: Francis Pollard</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-social-order-taylor-francis-ltd-9780415079167-bertrand-russell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415079167.jpg?v=1767770812</image:loc>
      <image:title>Education and the Social Order</image:title>
      <image:caption>Book cover of: Education and the Social Order. By: Bertrand Russell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtlichen-rahmenbedingungen-der-sanktionierung-von-beitragsverweigerung-im-system-der-vereinten-nationen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631353707</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631353707.jpg?v=1767770812</image:loc>
      <image:title>Die rechtlichen Rahmenbedingungen der Sanktionierung von Beitragsverweigerung im System der Vereinten Nationen</image:title>
      <image:caption>Book cover of: Die rechtlichen Rahmenbedingungen der Sanktionierung von Beitragsverweigerung im System der Vereinten Nationen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtslage-von-hongkong-und-macau-nach-den-gemeinsamen-erklaerungen-vom-19-dezember-1984-und-13-april-1987-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631457115-unter-besonderer-beruecksichtigung-der-chinesischen-verfassung-und-der-g</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631457115.jpg?v=1767770810</image:loc>
      <image:title>Die Rechtslage von Hongkong und Macau nach den «Gemeinsamen Erklaerungen» vom 19. Dezember 1984 und 13. April 1987</image:title>
      <image:caption>Book cover of: Die Rechtslage von Hongkong und Macau nach den «Gemeinsamen Erklaerungen» vom 19. Dezember 1984 und 13. April 1987</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtliche-und-rechtstatsaechliche-lage-der-neuen-selbstaendigen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631486665-insbesondere-in-der-baubranche</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631486665.jpg?v=1767770812</image:loc>
      <image:title>Die rechtliche und rechtstatsaechliche Lage der «Neuen Selbstaendigen»</image:title>
      <image:caption>Book cover of: Die rechtliche und rechtstatsaechliche Lage der «Neuen Selbstaendigen»</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-social-construction-of-race-rle-edu-j-taylor-francis-ltd-9780415694513-peter-figueroa</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415694513.jpg?v=1767770811</image:loc>
      <image:title>Education and the Social Construction of &apos;Race&apos; (RLE Edu J)</image:title>
      <image:caption>Book cover of: Education and the Social Construction of &apos;Race&apos; (RLE Edu J). By: Peter Figueroa</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtlichen-probleme-im-zusammenhang-mit-der-weiblichen-genitalverstuemmelung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631361436</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631361436.jpg?v=1767770813</image:loc>
      <image:title>Die rechtlichen Probleme im Zusammenhang mit der weiblichen Genitalverstuemmelung</image:title>
      <image:caption>Book cover of: Die rechtlichen Probleme im Zusammenhang mit der weiblichen Genitalverstuemmelung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtliche-und-wirtschaftliche-bedeutung-des-groupement-d-interet-economique-in-frankreich-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820463651</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820463651.jpg?v=1767770810</image:loc>
      <image:title>Die rechtliche und wirtschaftliche Bedeutung des «groupement d&apos;interet economique» in Frankreich</image:title>
      <image:caption>Book cover of: Die rechtliche und wirtschaftliche Bedeutung des «groupement d&apos;interet economique» in Frankreich</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtmaessigkeit-der-diensthandlung-in-113-abs-3-und-4-stgb-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631403358-historische-grundlagen-dogmatische-einordnung-und-inhaltliche-bestimmung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631403358.jpg?v=1767770811</image:loc>
      <image:title>Die Rechtmaessigkeit der Diensthandlung in  113 Abs. 3 und 4 StGB</image:title>
      <image:caption>Book cover of: Die Rechtmaessigkeit der Diensthandlung in  113 Abs. 3 und 4 StGB</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-social-order-taylor-francis-ltd-9781138168374-bertrand-russell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138168374.jpg?v=1767770812</image:loc>
      <image:title>Education and the Social Order</image:title>
      <image:caption>Book cover of: Education and the Social Order. By: Bertrand Russell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-social-condition-rle-edu-l-taylor-francis-ltd-9780415506175-harold-silver</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415506175.jpg?v=1767770813</image:loc>
      <image:title>Education and the Social Condition (RLE Edu L)</image:title>
      <image:caption>Book cover of: Education and the Social Condition (RLE Edu L). By: Harold Silver</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsetzung-der-bernischen-gemeinden-im-baurecht-peter-lang-international-academic-publishers-9783261015594</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261015594.jpg?v=1767770810</image:loc>
      <image:title>Die Rechtsetzung der bernischen Gemeinden im Baurecht</image:title>
      <image:caption>Book cover of: Die Rechtsetzung der bernischen Gemeinden im Baurecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtliche-stellung-der-frau-im-ehelichen-gueterrecht-vom-alr-zum-bgb-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631436592-petra-malsbenden</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631436592.jpg?v=1767770811</image:loc>
      <image:title>Die rechtliche Stellung der Frau im ehelichen Gueterrecht vom ALR zum BGB</image:title>
      <image:caption>Book cover of: Die rechtliche Stellung der Frau im ehelichen Gueterrecht vom ALR zum BGB. By: Petra Malsbenden</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-scandinavian-welfare-state-in-the-year-2000-taylor-francis-inc-9780815324768-equality-policy-and-reform-arild-tjeldvoll</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815324768.jpg?v=1767770814</image:loc>
      <image:title>Education and the Scandinavian Welfare State in the Year 2000</image:title>
      <image:caption>Book cover of: Education and the Scandinavian Welfare State in the Year 2000. By: Arild Tjeldvoll</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-second-world-war-taylor-francis-ltd-9780415689212-studies-in-schooling-and-social-change-roy-lowe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415689212.jpg?v=1767770811</image:loc>
      <image:title>Education and the Second World War</image:title>
      <image:caption>Book cover of: Education and the Second World War. By: Roy Lowe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtliche-problematik-von-strahlenschaeden-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631361962-rechtliche-und-rechtstatsaechliche-aspekte-der-haftung-fuer-strahlenschaeden-unter-einbeziehung-der-vorfaelle-in-der-strahlentherapeuti</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631361962.jpg?v=1767770811</image:loc>
      <image:title>Die rechtliche Problematik von Strahlenschaeden</image:title>
      <image:caption>Book cover of: Die rechtliche Problematik von Strahlenschaeden. By: Oliver Wendt</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtliche-gestaltung-kommunaler-oeffentlicher-unternehmen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820473834-grenzen-und-moeglichkeiten-der-gemeindlichen-organisationshoheit-unter-besonderer-beruecksichtigung-der-arbeitnehmermitb</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820473834.jpg?v=1767770812</image:loc>
      <image:title>Die rechtliche Gestaltung kommunaler oeffentlicher Unternehmen</image:title>
      <image:caption>Book cover of: Die rechtliche Gestaltung kommunaler oeffentlicher Unternehmen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtliche-stellung-der-deutschen-volksgruppe-in-polen-peter-lang-ag-9783631510025-eine-bilanz-nach-zehn-jahren-deutsch-polnischer-nachbarschaftsvertrag-jochen-hogrefe</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631510025.jpg?v=1767770815</image:loc>
      <image:title>Die Rechtliche Stellung Der Deutschen Volksgruppe in Polen</image:title>
      <image:caption>Book cover of: Die Rechtliche Stellung Der Deutschen Volksgruppe in Polen. By: Jochen Hogrefe</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechte-und-pflichten-der-reservisten-aus-staatsbuergerlicher-und-wehrrechtlicher-sicht-peter-lang-international-academic-publishers-9783261021144</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261021144.jpg?v=1767770812</image:loc>
      <image:title>Die Rechte und Pflichten der Reservisten aus staatsbuergerlicher und wehrrechtlicher Sicht</image:title>
      <image:caption>Book cover of: Die Rechte und Pflichten der Reservisten aus staatsbuergerlicher und wehrrechtlicher Sicht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtliche-zulaessigkeit-von-tarifvertraegen-zugunsten-gewerkschaftlicher-vertrauensleute-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820469691</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820469691.jpg?v=1767770814</image:loc>
      <image:title>Die rechtliche Zulaessigkeit von Tarifvertraegen zugunsten gewerkschaftlicher Vertrauensleute</image:title>
      <image:caption>Book cover of: Die rechtliche Zulaessigkeit von Tarifvertraegen zugunsten gewerkschaftlicher Vertrauensleute</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechte-der-glaeubiger-bei-dm-auslandsanleihen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820414622</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820414622.jpg?v=1767770812</image:loc>
      <image:title>Die Rechte der Glaeubiger bei DM-Auslandsanleihen</image:title>
      <image:caption>Book cover of: Die Rechte der Glaeubiger bei DM-Auslandsanleihen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtliche-stellung-der-frau-im-privatrecht-des-preussischen-allgemeinen-landrechts-von-1794-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820478358</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820478358.jpg?v=1767770813</image:loc>
      <image:title>Die rechtliche Stellung der Frau im Privatrecht des preussischen allgemeinen Landrechts von 1794</image:title>
      <image:caption>Book cover of: Die rechtliche Stellung der Frau im Privatrecht des preussischen allgemeinen Landrechts von 1794</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-social-construction-of-race-rle-edu-j-taylor-francis-ltd-9780415751049-peter-figueroa</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415751049.jpg?v=1767770813</image:loc>
      <image:title>Education and the Social Construction of &apos;Race&apos; (RLE Edu J)</image:title>
      <image:caption>Book cover of: Education and the Social Construction of &apos;Race&apos; (RLE Edu J). By: Peter Figueroa</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-social-condition-rle-edu-l-taylor-francis-ltd-9780415753067-harold-silver</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415753067.jpg?v=1767770810</image:loc>
      <image:title>Education and the Social Condition (RLE Edu L)</image:title>
      <image:caption>Book cover of: Education and the Social Condition (RLE Edu L). By: Harold Silver</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-rise-of-the-global-economy-taylor-francis-inc-9780805830132</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805830132.jpg?v=1767770811</image:loc>
      <image:title>Education and the Rise of the Global Economy</image:title>
      <image:caption>Book cover of: Education and the Rise of the Global Economy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtliche-regelung-von-boykotterklaerungen-nach-4a-awv-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631308080</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631308080.jpg?v=1767770811</image:loc>
      <image:title>Die rechtliche Regelung von Boykotterklaerungen nach  4a AWV</image:title>
      <image:caption>Book cover of: Die rechtliche Regelung von Boykotterklaerungen nach  4a AWV</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-rise-of-the-global-economy-taylor-francis-inc-9780805830125</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780805830125.jpg?v=1767770812</image:loc>
      <image:title>Education and the Rise of the Global Economy</image:title>
      <image:caption>Book cover of: Education and the Rise of the Global Economy</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtliche-behandlung-von-glaubens-und-gewissenskonflikten-im-arbeitsverhaeltnis-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631352670</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631352670.jpg?v=1767770813</image:loc>
      <image:title>Die rechtliche Behandlung von Glaubens- und Gewissenskonflikten im Arbeitsverhaeltnis</image:title>
      <image:caption>Book cover of: Die rechtliche Behandlung von Glaubens- und Gewissenskonflikten im Arbeitsverhaeltnis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-nation-state-taylor-francis-ltd-9780415633390-the-selected-works-of-s-gopinathan-saravanan-gopinathan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415633390.jpg?v=1767770812</image:loc>
      <image:title>Education and the Nation State</image:title>
      <image:caption>Book cover of: Education and the Nation State. By: Saravanan Gopinathan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-pursuit-of-wisdom-taylor-francis-inc-9780815355083-the-aims-of-education-revisited-j-nis-ozoli-s</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780815355083.jpg?v=1767770812</image:loc>
      <image:title>Education and the Pursuit of Wisdom</image:title>
      <image:caption>Book cover of: Education and the Pursuit of Wisdom. By: Jānis Ozoliņs</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-politics-of-becoming-taylor-francis-ltd-9781138949157-diana-masny</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138949157.jpg?v=1767770814</image:loc>
      <image:title>Education and the Politics of Becoming</image:title>
      <image:caption>Book cover of: Education and the Politics of Becoming. By: Diana Masny</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechnungslegung-nach-der-equity-methode-im-konsolidierten-abschlu-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631304372-ein-beitrag-zur-entstehung-anwendung-und-ausgestaltung-des-verfahrens-vor-dem-hintergrund-der-bestimmungen-in-der</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631304372.jpg?v=1767770813</image:loc>
      <image:title>Die Rechnungslegung nach der Equity-Methode im konsolidierten Abschlu</image:title>
      <image:caption>Book cover of: Die Rechnungslegung nach der Equity-Methode im konsolidierten Abschlu</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-nation-state-taylor-francis-ltd-9780415719018-the-selected-works-of-s-gopinathan-s-gopinathan</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415719018.jpg?v=1767770811</image:loc>
      <image:title>Education and the Nation State</image:title>
      <image:caption>Book cover of: Education and the Nation State. By: S. Gopinathan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-limits-of-reason-taylor-francis-ltd-9780415834148-reading-dostoevsky-tolstoy-and-nabokov-peter-roberts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415834148.jpg?v=1767770816</image:loc>
      <image:title>Education and the Limits of Reason</image:title>
      <image:caption>Book cover of: Education and the Limits of Reason. By: Peter Roberts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-realisierbarkeit-von-wohneigentum-bei-alternativen-wirtschaftlichen-entwicklungen-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631447628-ein-modellansatz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631447628.jpg?v=1767770811</image:loc>
      <image:title>Die Realisierbarkeit von Wohneigentum bei alternativen wirtschaftlichen Entwicklungen</image:title>
      <image:caption>Book cover of: Die Realisierbarkeit von Wohneigentum bei alternativen wirtschaftlichen Entwicklungen</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtsbeziehungen-zwischen-dem-land-hessen-und-der-katholischen-kirche-unter-besonderer-beruecksichtigung-der-bistumsvertraege-vom-9-maerz-1963-und-29-maerz-1974-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820494884</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820494884.jpg?v=1767770814</image:loc>
      <image:title>Die Rechtsbeziehungen zwischen dem Land Hessen und der katholischen Kirche unter besonderer Beruecksichtigung der Bistumsvertraege vom 9. Maerz 1963 und 29. Maerz 1974</image:title>
      <image:caption>Book cover of: Die Rechtsbeziehungen zwischen dem Land Hessen und der katholischen Kirche unter besonderer Beruecksichtigung der Bistumsvertraege vom 9. Maerz 1963 und 29. Maerz 1974</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-realitaet-des-moralischen-handelns-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631307472-mou-zongsans-darstellung-des-neokonfuzianismus-als-vollendung-der-praktischen-philosophie-kants</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631307472.jpg?v=1767770813</image:loc>
      <image:title>Die Realitaet des moralischen Handelns</image:title>
      <image:caption>Book cover of: Die Realitaet des moralischen Handelns</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-production-of-space-taylor-francis-ltd-9780367194376-political-pedagogy-geography-and-urban-revolution-derek-ford</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367194376.jpg?v=1767770814</image:loc>
      <image:title>Education and the Production of Space</image:title>
      <image:caption>Book cover of: Education and the Production of Space. By: Derek Ford</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-realistische-kindergeschichte-in-der-bundesrepublik-deutschland-und-in-der-deutschen-demokratischen-republik-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820465198</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820465198.jpg?v=1767770813</image:loc>
      <image:title>Die realistische Kindergeschichte in der Bundesrepublik Deutschland und in der Deutschen Demokratischen Republik</image:title>
      <image:caption>Book cover of: Die realistische Kindergeschichte in der Bundesrepublik Deutschland und in der Deutschen Demokratischen Republik</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechte-des-minderheitengesellschafters-einer-ag-und-einer-gmbh-in-taiwan-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631498170-eine-rechtsvergleichende-untersuchung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631498170.jpg?v=1767770811</image:loc>
      <image:title>Die Rechte des Minderheitengesellschafters einer AG und einer GmbH in Taiwan</image:title>
      <image:caption>Book cover of: Die Rechte des Minderheitengesellschafters einer AG und einer GmbH in Taiwan</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-realwirtschaftliche-bedeutung-von-banken-peter-lang-ag-9783631512708-andreas-gontermann</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631512708.jpg?v=1767770814</image:loc>
      <image:title>Die Realwirtschaftliche Bedeutung Von Banken</image:title>
      <image:caption>Book cover of: Die Realwirtschaftliche Bedeutung Von Banken. By: Andreas Gontermann</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-scandinavian-welfare-state-in-the-year-2000-taylor-francis-ltd-9781138968387-equality-policy-and-reform-arild-tjeldvoll</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138968387.jpg?v=1767770813</image:loc>
      <image:title>Education and the Scandinavian Welfare State in the Year 2000</image:title>
      <image:caption>Book cover of: Education and the Scandinavian Welfare State in the Year 2000. By: Arild Tjeldvoll</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-law-taylor-francis-ltd-9780415089432-international-perspectives-w-tulasiewicz</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415089432.jpg?v=1767770813</image:loc>
      <image:title>Education and the Law</image:title>
      <image:caption>Book cover of: Education and the Law. By: W. Tulasiewicz</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechtliche-absicherung-von-direktinvestitionen-in-albanien-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631315651</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631315651.jpg?v=1767770815</image:loc>
      <image:title>Die rechtliche Absicherung von Direktinvestitionen in Albanien</image:title>
      <image:caption>Book cover of: Die rechtliche Absicherung von Direktinvestitionen in Albanien</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-production-of-space-taylor-francis-ltd-9781138229525-political-pedagogy-geography-and-urban-revolution-derek-r-ford</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138229525.jpg?v=1767770812</image:loc>
      <image:title>Education and the Production of Space</image:title>
      <image:caption>Book cover of: Education and the Production of Space. By: Derek R. Ford</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-social-order-taylor-francis-ltd-9781138152403-bertrand-russell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9781138152403.jpg?v=1767770816</image:loc>
      <image:title>Education and the Social Order</image:title>
      <image:caption>Book cover of: Education and the Social Order. By: Bertrand Russell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rechte-am-menschlichen-koerper-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820453539</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820453539.jpg?v=1767770815</image:loc>
      <image:title>Die Rechte am menschlichen Koerper</image:title>
      <image:caption>Book cover of: Die Rechte am menschlichen Koerper</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-politics-of-becoming-taylor-francis-ltd-9780415741194</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415741194.jpg?v=1767770815</image:loc>
      <image:title>Education and the Politics of Becoming</image:title>
      <image:caption>Book cover of: Education and the Politics of Becoming</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-historic-environment-taylor-francis-ltd-9780415284271-don-henson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415284271.jpg?v=1767770816</image:loc>
      <image:title>Education and the Historic Environment</image:title>
      <image:caption>Book cover of: Education and the Historic Environment. By: Don Henson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-historic-environment-taylor-francis-ltd-9780415284288-don-henson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415284288.jpg?v=1767770814</image:loc>
      <image:title>Education and the Historic Environment</image:title>
      <image:caption>Book cover of: Education and the Historic Environment. By: Don Henson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-professions-taylor-francis-ltd-9780415432399-history-of-education-society</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415432399.jpg?v=1767770813</image:loc>
      <image:title>Education and the Professions</image:title>
      <image:caption>Book cover of: Education and the Professions. By: History of Education Society</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-labour-government-taylor-francis-ltd-9780415464123-an-evaluation-of-two-terms-geoffre-walford</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415464123.jpg?v=1767770813</image:loc>
      <image:title>Education and the Labour Government</image:title>
      <image:caption>Book cover of: Education and the Labour Government. By: Geoffre Walford</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-professions-taylor-francis-ltd-9780415761703-history-of-history-of-education-society</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415761703.jpg?v=1767770813</image:loc>
      <image:title>Education and the Professions</image:title>
      <image:caption>Book cover of: Education and the Professions. By: History of History of Education Society</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-raumwirksamkeit-wechselseitiger-direktinvestitionen-zwischen-deutschland-und-oesterreich-peter-lang-ag-9783631555774</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631555774.jpg?v=1767770816</image:loc>
      <image:title>Die Raumwirksamkeit Wechselseitiger Direktinvestitionen Zwischen Deutschland Und Oesterreich</image:title>
      <image:caption>Book cover of: Die Raumwirksamkeit Wechselseitiger Direktinvestitionen Zwischen Deutschland Und Oesterreich</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-quelle-der-italienischen-literatur-in-weimar-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783899756760-sprachlehre-und-sprachwissenschaft-bei-christian-joseph-jagemann-und-carl-ludwig-fernow-margrit-glaser</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783899756760.jpg?v=1767770815</image:loc>
      <image:title>Die Quelle Der Italienischen Literatur in Weimar</image:title>
      <image:caption>Book cover of: Die Quelle Der Italienischen Literatur in Weimar. By: Margrit Glaser</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-rationale-planung-und-oekonomische-bewertung-von-infrastrukturmassnahmen-unter-besonderer-beruecksichtigung-der-oeffentlichen-personennahverkehrsinvestitionen-in-der-bundesrepublik-deutschland-peter-lang-international-academic-publishers-9783261016027</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783261016027.jpg?v=1767770814</image:loc>
      <image:title>Die rationale Planung und oekonomische Bewertung von Infrastrukturmassnahmen unter besonderer Beruecksichtigung der oeffentlichen Personennahverkehrsinvestitionen in der Bundesrepublik Deutschland</image:title>
      <image:caption>Book cover of: Die rationale Planung und oekonomische Bewertung von Infrastrukturmassnahmen unter besonderer Beruecksichtigung der oeffentlichen Personennahverkehrsinvestitionen in der Bundesrepublik Deutschland. By: Rainer Rocker</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-realteilung-von-mitunternehmerschaften-im-einkommensteuerrecht-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820469929</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820469929.jpg?v=1767770813</image:loc>
      <image:title>Die Realteilung von Mitunternehmerschaften im Einkommensteuerrecht</image:title>
      <image:caption>Book cover of: Die Realteilung von Mitunternehmerschaften im Einkommensteuerrecht</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-labour-government-taylor-francis-ltd-9780415368704-an-evaluation-of-two-terms-geoffrey-walford</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415368704.jpg?v=1767770816</image:loc>
      <image:title>Education and the Labour Government</image:title>
      <image:caption>Book cover of: Education and the Labour Government. By: Geoffrey Walford</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-handicapped-1760-1960-taylor-francis-ltd-9780415177573-d-g-pritchard</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780415177573.jpg?v=1767770814</image:loc>
      <image:title>Education and the Handicapped 1760 - 1960</image:title>
      <image:caption>Book cover of: Education and the Handicapped 1760 - 1960. By: D.G. Pritchard</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-reaktion-des-aktienmarktes-auf-die-einfuehrung-von-standardisierten-aktienoptionen-peter-lang-ag-internationaler-verlag-der-wissenschaften-9783906761657-eine-empirische-untersuchung-fuer-deutschland-oesterreich-und-die-schweiz-peter-windlin</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783906761657.jpg?v=1767770815</image:loc>
      <image:title>Die Reaktion des Aktienmarktes auf die Einfuehrung von standardisierten Aktienoptionen</image:title>
      <image:caption>Book cover of: Die Reaktion des Aktienmarktes auf die Einfuehrung von standardisierten Aktienoptionen. By: Peter Windlin</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-quantifizierung-der-steuerbelastung-im-internationalen-bereich-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820480443-unter-beruecksichtigung-der-moeglichkeiten-der-steuerbilanzpolitik-im-investitionsland</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820480443.jpg?v=1767770815</image:loc>
      <image:title>Die Quantifizierung der Steuerbelastung im internationalen Bereich</image:title>
      <image:caption>Book cover of: Die Quantifizierung der Steuerbelastung im internationalen Bereich</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-raeumliche-verteilung-des-dienstleistungsbereiches-in-bayern-eine-theoretische-und-empirische-untersuchung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631418994-eine-theoretische-und-empirische-untersuchung</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631418994.jpg?v=1767770816</image:loc>
      <image:title>Die raeumliche Verteilung des Dienstleistungsbereiches in Bayern.- Eine theoretische und empirische Untersuchung</image:title>
      <image:caption>Book cover of: Die raeumliche Verteilung des Dienstleistungsbereiches in Bayern.- Eine theoretische und empirische Untersuchung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-good-life-ww-norton-co-9780871402127-bertrand-russell</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780871402127.jpg?v=1767770814</image:loc>
      <image:title>Education and the Good Life</image:title>
      <image:caption>Book cover of: Education and the Good Life. By: Bertrand Russell</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-querulatorische-justizdienstaufsichtsbeschwerde-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820496215</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820496215.jpg?v=1767770816</image:loc>
      <image:title>Die querulatorische Justizdienstaufsichtsbeschwerde</image:title>
      <image:caption>Book cover of: Die querulatorische Justizdienstaufsichtsbeschwerde</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-limits-of-reason-taylor-francis-ltd-9780367178581-reading-dostoevsky-tolstoy-and-nabokov-peter-roberts</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367178581.jpg?v=1767770816</image:loc>
      <image:title>Education and the Limits of Reason</image:title>
      <image:caption>Book cover of: Education and the Limits of Reason. By: Peter Roberts</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-qualifikation-der-schenkung-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783631311172-zur-methode-der-qualifikation-im-internationalen-schuldvertragsrecht</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783631311172.jpg?v=1767770814</image:loc>
      <image:title>Die Qualifikation der Schenkung</image:title>
      <image:caption>Book cover of: Die Qualifikation der Schenkung</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/die-qualifizierte-oligopolvermutung-in-23-a-ii-gwb-peter-lang-gmbh-internationaler-verlag-der-wissenschaften-9783820493887</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9783820493887.jpg?v=1767770816</image:loc>
      <image:title>Die qualifizierte Oligopolvermutung in  23 a II GWB</image:title>
      <image:caption>Book cover of: Die qualifizierte Oligopolvermutung in  23 a II GWB</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-market-place-taylor-francis-ltd-9780750703499</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780750703499.jpg?v=1767770814</image:loc>
      <image:title>Education And The Market Place</image:title>
      <image:caption>Book cover of: Education And The Market Place</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-mobility-turn-taylor-francis-ltd-9780367001810-kalervo-n-gulson</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780367001810.jpg?v=1767770813</image:loc>
      <image:title>Education and the Mobility Turn</image:title>
      <image:caption>Book cover of: Education and the Mobility Turn. By: Kalervo N. Gulson</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.bookshop.lt/products/education-and-the-french-revolution-cambridge-university-press-9780521108881-h-c-barnard</loc>
    <lastmod>2026-04-24T04:12:48+03:00</lastmod>
    <changefreq>daily</changefreq>
    <image:image>
      <image:loc>https://cdn.shopify.com/s/files/1/0886/3206/6390/files/9780521108881.jpg?v=1767770814</image:loc>
      <image:title>Education and the French Revolution</image:title>
      <image:caption>Book cover of: Education and the French Revolution. By: H. C. Barnard</image:caption>
    </image:image>
  </url>
</urlset>
